[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68812.1
DDBJ      :             hemolysin-coregulated protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  114/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.157.1
:161 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->158 1y12B PDBj 4e-24 43.0 %
:RPS:PDB   4->160 3eaaA PDBj 3e-33 32.5 %
:RPS:SCOP  4->160 1y12A1  b.157.1.1 * 8e-48 44.5 %
:HMM:SCOP  2->161 1y12A1 b.157.1.1 * 1.9e-51 46.5 %
:RPS:PFM   6->137 PF05638 * DUF796 2e-18 40.8 %
:HMM:PFM   6->136 PF05638 * DUF796 6e-45 44.6 130/132  
:BLT:SWISS 1->158 HCP1_PSEAE 3e-25 38.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68812.1 GT:GENE ACF68812.1 GT:PRODUCT hemolysin-coregulated protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 326646..327131 GB:FROM 326646 GB:TO 327131 GB:DIRECTION + GB:PRODUCT hemolysin-coregulated protein GB:NOTE identified by match to protein family HMM PF05638; match to protein family HMM TIGR03344 GB:PROTEIN_ID ACF68812.1 GB:DB_XREF GI:194408593 LENGTH 161 SQ:AASEQ MSYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLSFEHYIDRASPNLFKYCSSGKHIPQAILVMRKAGGNPLEYLKYTFTDLIIAMVSPSGSQGGEIASRESIELSFSTVKQEYVVQNQQGGSGGTITAGYDFKANKEI GT:EXON 1|1-161:0| BL:SWS:NREP 1 BL:SWS:REP 1->158|HCP1_PSEAE|3e-25|38.2|157/100| BL:PDB:NREP 1 BL:PDB:REP 6->158|1y12B|4e-24|43.0|142/150| RP:PDB:NREP 1 RP:PDB:REP 4->160|3eaaA|3e-33|32.5|154/158| RP:PFM:NREP 1 RP:PFM:REP 6->137|PF05638|2e-18|40.8|130/132|DUF796| HM:PFM:NREP 1 HM:PFM:REP 6->136|PF05638|6e-45|44.6|130/132|DUF796| RP:SCP:NREP 1 RP:SCP:REP 4->160|1y12A1|8e-48|44.5|155/160|b.157.1.1| HM:SCP:REP 2->161|1y12A1|1.9e-51|46.5|159/0|b.157.1.1|1/1|Hcp1-like| OP:NHOMO 217 OP:NHOMOORG 114 OP:PATTERN -------------------------------------------------------------------- --1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------11---------------------------1-------111---1----3------11-11----------------1--------------------------------------11-12----11333311234444-33-4111---1--1-1--1---2--------1------------31---------------1-1-----------1----------------------------------1-----1-----------1--------------------2----1-----------------------------------1--2-242424423242422---------122222222222---1-----------21----------------1111111---2-2222-11213412--74--------------------------1-2--222--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 159 STR:RPRED 98.8 SQ:SECSTR #ccEEEEEETTcccccccGGGTTcEEEccccccEEEccccccccccTccccccEccEEEEEEcccHHHHHHHHHHTccEEEEEEEEEcccTTccEEEEEEEEEEEEEEEEEEcccccccccEEEEEEEccEEEcccccccTTcccccccccEEETTTTEE# DISOP:02AL 1-1,37-50,112-118,140-147,161-162| PSIPRED ccccEEEEEccccccccccccccEEEEEEEEEcEEEEcccccccccccccEEEccEEEEEEEccccHHHHHHHHcccEEcEEEEEEEEccccEEEEEEEEEccEEEEEEEEcccccccccEEEEEEEEEEEEEEEEEEEccccccEEEEEEEEEccccccc //