[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68832.1
DDBJ      :             2,3-dihydroxybenzoate-AMP ligase
Swiss-Prot:             

Homologs  Archaea  53/68 : Bacteria  804/915 : Eukaryota  193/199 : Viruses  0/175   --->[See Alignment]
e.23.1
:536 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->533 1mdbA PDBj e-129 47.8 %
:RPS:PDB   10->531 2d1sA PDBj 1e-68 17.8 %
:RPS:SCOP  5->533 1md9A  e.23.1.1 * e-120 45.7 %
:HMM:SCOP  26->533 1pg4A_ e.23.1.1 * 7.9e-135 35.5 %
:RPS:PFM   50->461 PF00501 * AMP-binding 3e-52 36.5 %
:HMM:PFM   50->461 PF00501 * AMP-binding 1.4e-87 32.1 405/418  
:HMM:PFM   5->31 PF03472 * Autoind_bind 0.00073 29.6 27/149  
:BLT:SWISS 1->534 ENTE_ECOLI 0.0 86.5 %
:PROS 187->198|PS00455|AMP_BINDING

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68832.1 GT:GENE ACF68832.1 GT:PRODUCT 2,3-dihydroxybenzoate-AMP ligase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 705870..707480 GB:FROM 705870 GB:TO 707480 GB:DIRECTION + GB:PRODUCT 2,3-dihydroxybenzoate-AMP ligase GB:NOTE identified by match to protein family HMM PF00501; match to protein family HMM TIGR02275 GB:PROTEIN_ID ACF68832.1 GB:DB_XREF GI:194408613 LENGTH 536 SQ:AASEQ MRIPFTRWPDEFARRYREKGYWQDVPLTDILTRHADSDKTAVIEGERAFSYRQLNQAADNLACYLRRQGIKPGETALVQLGNVPELYITFFALLKLGVAPVLALFSHQRTELNAYAMQIAPTLVIADRQHTLFAGEDFLNTFVAEHRSVRVVLLRNDDGDHSLDAAMRQAAEDFTATPSPADEVAYFQLSGGTTGTPKLIPRTHNDYYYSVRRSNEICGFNEETRFLCAIPAAHNYAMSSPGALGVFLAKGTVVLATDPSATLCFPLIEKHQINATALVPPAVSLWLQAIQEWGGNAPLASLRLLQVGGARLSATLAARIPAEIGCQLQQVFGMAEGLVNYTRLDDSPERIINTQGRPMCPDDEVWVADADGNPLPPGEIGRLMTRGPYTFRGYFNSPQHNASAFDANGFYCSGDLISIDQDGYITVHGREKDQINRGGEKIAAEEIENLLLRHPAVIHAALVSMEDELLGEKSCAYLVVKEPLRAVQVRRFLREQGVAEFKLPDRVECVASLPLTPVGKVDKKQLRQRLASRSPL GT:EXON 1|1-536:0| BL:SWS:NREP 1 BL:SWS:REP 1->534|ENTE_ECOLI|0.0|86.5|534/536| PROS 187->198|PS00455|AMP_BINDING|PDOC00427| BL:PDB:NREP 1 BL:PDB:REP 5->533|1mdbA|e-129|47.8|519/536| RP:PDB:NREP 1 RP:PDB:REP 10->531|2d1sA|1e-68|17.8|516/538| RP:PFM:NREP 1 RP:PFM:REP 50->461|PF00501|3e-52|36.5|397/405|AMP-binding| HM:PFM:NREP 2 HM:PFM:REP 50->461|PF00501|1.4e-87|32.1|405/418|AMP-binding| HM:PFM:REP 5->31|PF03472|0.00073|29.6|27/149|Autoind_bind| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00501|IPR000873| GO:PFM GO:0008152|"GO:metabolic process"|PF00501|IPR000873| RP:SCP:NREP 1 RP:SCP:REP 5->533|1md9A|e-120|45.7|525/536|e.23.1.1| HM:SCP:REP 26->533|1pg4A_|7.9e-135|35.5|502/643|e.23.1.1|1/1|Acetyl-CoA synthetase-like| OP:NHOMO 9827 OP:NHOMOORG 1050 OP:PATTERN 44-2--9HKJLLJJGA1164642JB444316A3231--333317666954423----1---145---2 47B6d854445E6DXvcOO-Ng77moOOOOOQlioig***3bDb31243751B6B988--PLJ3aJgULb83122323-398G313317654-5111--218--1E12311------1111111142545324353BBBDE222Z889E4FFF12332224113225JAV412211113112175566--3D9QDDEDEHCGCEEFGJC78EEHKDEJBJDDC46333333V3244444444444444533352-2-22-1111121122121233111112213114211111111111111111111111111112211121---51111511-1-I266------61-81271C94263--B31111-11914KAAG1111188aQg646XRZRP34443343445-CBIDCMCEBKL-988D68786BA7DK898ACL7B88BBI22222222C3225BB7----------111111111111111----2EGbE-6JI9HIMOPPPMHJJFEDJSTTTRBMTGfYipa36IIFBEDFDVBIMYR33E2132942222222547HAB2kKA6668677665-5875735577897eM99-121-221221131-11-1112227118B1556748656444489766547475477--13B63------E6H9855899F8EEA87-889888A8AA9AA88788886BA9MR58677888888778778A57577861-677767555464---412131777658M29111121-111-211299AB94A9AAF5MPLNSQMLBIIJE8JFQ43333434323239677777527766644443332222--3-2222111221111141------------------------------------291 -211ME7-C51-55GPPSKYOVRaaZlIJEHEHNSNILCLEKLGEHH9HSQSQRHFLGEDCDE2232232321222221242222213-FLAPDAA433364FIJF17A6N8JAC6C5124594JB285JwA1ACH5652C43763644-B3-K5C68JFHKBWCQELCTE9CPG3266g87694LLItNVT54FBEAD ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 535 STR:RPRED 99.8 SQ:SECSTR TcGGGHEccTcEEcccccccccccccHHHHHHHHHHHHHTcEEETccEEEHHHHHHHHHHHHHHHHHHTccTTcEEEEEccccTTTHHHHHHHHHHTcEEEEEcTTccHHHHHHHHHHHcccEEEEcTTTHHHHHHHHcTTcETTcccccTTcccHHHHHHHTccTTccGGGcccccccTTTcEEEEEcccccccccccEEEEHHHHHHHHTcTTTcccccTTcEEEEcccTTTTcHHHHHHHHHHHHTTcEEEEcccccHHHHHHHHHHTTEEEEEEcHHHHHHHHHcccGGGcccccTTccEEEEccccccHHHHHHHHHHTTccccEEEEEcGGGccEEEEccTTcccTTcccEEcTTcEEEEEcTTTcccccTTccEEEEEEcTTcccEETTcHHHHHHHccTTccEEEEEEEEEcTTccEEEEEEGGGccccTTccccHHHHHHHHHTcTTEEEEEEEEEEETTTEEEEEEEEEEcTTccccHHHHHHHTTccGGGccTTcEEEcccccccTTccccHHHHHHHHHcHHT# DISOP:02AL 1-1,532-537| PSIPRED cccccccccHHHHcccccccccccccHHHHHHHHcccccEEEEEccEEEEHHHHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHHccEEEcccccccHHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHcccccccccccccccEEEEEEccccccccccEEEcHHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHHHHHHccEEEEcccccHHHHHHHHHHHcccEEEcHHHHHHHHHHcccccccccccccccEEEEccccccHHHHHHHHHHHccEEEEEEcccHHHcEEEcccccHHHcccccccccccccEEEEEccccccccccccEEEEEccHHHHHHHcccHHHHHHHHcccccccccEEEEEcccccEEEEEEcccEEEEccEEEcHHHHHHHHHHcccEEEEEEEEEEccccccEEEEEEEccccccHHHHHHHHHHccccccccccEEEEEccccccccccccHHHHHHHHHccccc //