[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68861.1
DDBJ      :             putative inner membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:37 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->27 PF11044 * TMEMspv1-c74-12 5.3e-05 42.9 21/49  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68861.1 GT:GENE ACF68861.1 GT:PRODUCT putative inner membrane protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2905518..2905631 GB:FROM 2905518 GB:TO 2905631 GB:DIRECTION + GB:PRODUCT putative inner membrane protein GB:PROTEIN_ID ACF68861.1 GB:DB_XREF GI:194408642 LENGTH 37 SQ:AASEQ MTHADWLILGYTTVIIIFGIVCYIGLLKLITKGKHEK GT:EXON 1|1-37:0| TM:NTM 1 TM:REGION 9->31| HM:PFM:NREP 1 HM:PFM:REP 6->27|PF11044|5.3e-05|42.9|21/49|TMEMspv1-c74-12| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11-1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,34-38| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //