[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68865.1
DDBJ      :             probable secreted protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  31/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.230.6
:96 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->96 2jnaA PDBj 5e-49 99.0 %
:RPS:SCOP  1->96 2jnaA1  d.230.6.1 * 3e-20 99.0 %
:HMM:PFM   23->92 PF07338 * DUF1471 6.4e-24 47.7 65/65  
:BLT:SWISS 16->91 YJFY_SHIFL 6e-06 32.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68865.1 GT:GENE ACF68865.1 GT:PRODUCT probable secreted protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(90025..90315) GB:FROM 90025 GB:TO 90315 GB:DIRECTION - GB:PRODUCT probable secreted protein GB:NOTE identified by match to protein family HMM PF07338 GB:PROTEIN_ID ACF68865.1 GB:DB_XREF GI:194408646 LENGTH 96 SQ:AASEQ MKKRIIAAALLATVASFSTLAAEQVSKQEISHFKLVKVGTINVSQSGEQISSPSDLREKLSELADAKGGKYYHIIAAREHGPNFEAVAEVYNDATK GT:EXON 1|1-96:0| BL:SWS:NREP 1 BL:SWS:REP 16->91|YJFY_SHIFL|6e-06|32.4|74/91| BL:PDB:NREP 1 BL:PDB:REP 1->96|2jnaA|5e-49|99.0|96/104| HM:PFM:NREP 1 HM:PFM:REP 23->92|PF07338|6.4e-24|47.7|65/65|DUF1471| RP:SCP:NREP 1 RP:SCP:REP 1->96|2jnaA1|3e-20|99.0|96/96|d.230.6.1| OP:NHOMO 36 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------222-----1-11-111111111112---------211111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 96 STR:RPRED 100.0 SQ:SECSTR ccccccccccccccccccccccccccHHHHHHHTcEEEEEEEEEEEccccccHHHHHHHHHHHHHHHTccEEEEEEEEEETTEEEEEEEEEEcTTc DISOP:02AL 1-2,57-57,94-97| PSIPRED ccHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccccEEEEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEEEEEcccccHHHHHHHHHccc //