[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68878.1
DDBJ      :             antitermination protein Q
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  51/915 : Eukaryota  0/199 : Viruses  6/175   --->[See Alignment]
a.138.1g.54.1
:265 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   99->174 1eb7A PDBj 1e-06 17.1 %
:RPS:SCOP  113->187 1hh5A  a.138.1.1 * 3e-05 17.2 %
:RPS:SCOP  167->217 1nltA3  g.54.1.1 * 3e-04 15.7 %
:HMM:SCOP  165->234 1nltA3 g.54.1.1 * 4e-05 25.7 %
:RPS:PFM   36->109 PF03589 * Antiterm 3e-04 31.6 %
:RPS:PFM   175->260 PF03589 * Antiterm 6e-09 42.0 %
:HMM:PFM   14->109 PF03589 * Antiterm 2.7e-18 31.8 88/95  
:HMM:PFM   175->260 PF03589 * Antiterm 1.6e-30 43.0 86/95  
:HMM:PFM   99->122 PF03150 * CCP_MauG 0.00023 33.3 24/157  
:BLT:SWISS 1->265 REQ2_ECOLI 5e-35 38.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68878.1 GT:GENE ACF68878.1 GT:PRODUCT antitermination protein Q GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1117602..1118399 GB:FROM 1117602 GB:TO 1118399 GB:DIRECTION + GB:PRODUCT antitermination protein Q GB:PROTEIN_ID ACF68878.1 GB:DB_XREF GI:194408659 LENGTH 265 SQ:AASEQ MNLESLPKYFSPKSMMPGAVPCGITSDTLTITDVMASLGLLTAKAAVGIELYLAKAGVLSSENIIAYIRQLAEQRAERHGALRKMEKGKRSKFLDTMARYVFRDYSLSAASLVTCSSCHGAKLIDAEVFTNKVTYPDGKPPKWVKDTKGISPSDWEVWKSVREQVRVVCKACDGKGHVKNECRCRGRGEILDKKKSELQGVPVYKKCPRCKGRGYPRLKDTEIFKALGVTEMVWRYNYKLFFDRLVEHCHIEESYAEKVLGNVTR GT:EXON 1|1-265:0| BL:SWS:NREP 1 BL:SWS:REP 1->265|REQ2_ECOLI|5e-35|38.1|244/250| RP:PDB:NREP 1 RP:PDB:REP 99->174|1eb7A|1e-06|17.1|76/317| RP:PFM:NREP 2 RP:PFM:REP 36->109|PF03589|3e-04|31.6|73/90|Antiterm| RP:PFM:REP 175->260|PF03589|6e-09|42.0|81/90|Antiterm| HM:PFM:NREP 3 HM:PFM:REP 14->109|PF03589|2.7e-18|31.8|88/95|Antiterm| HM:PFM:REP 175->260|PF03589|1.6e-30|43.0|86/95|Antiterm| HM:PFM:REP 99->122|PF03150|0.00023|33.3|24/157|CCP_MauG| GO:PFM:NREP 4 GO:PFM GO:0003677|"GO:DNA binding"|PF03589|IPR003222| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF03589|IPR003222| GO:PFM GO:0003677|"GO:DNA binding"|PF03589|IPR003222| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF03589|IPR003222| RP:SCP:NREP 2 RP:SCP:REP 113->187|1hh5A|3e-05|17.2|64/68|a.138.1.1| RP:SCP:REP 167->217|1nltA3|3e-04|15.7|51/74|g.54.1.1| HM:SCP:REP 165->234|1nltA3|4e-05|25.7|70/74|g.54.1.1|1/1|DnaJ/Hsp40 cysteine-rich domain| OP:NHOMO 80 OP:NHOMOORG 57 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----1122212-311-312--11122231112-12111---1121-122111-112111--211-12----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------1-----1---------------------------------------------1---------------------------------------------111----------------------------- STR:NPRED 149 STR:RPRED 56.2 SQ:SECSTR ##########################################################ccHHHHHHHHHHHcccccccccEEcccccEEccHHHHHHHHHHHHcGGGcTTccccHHHHccTTTTTccccccccccTTccccccccccTTGGGccccccEEETTGGGTccccHHHcccccccHHHHHHHHTTcHHHHH###HHHccccccc####################################################### DISOP:02AL 1-4,15-25,264-266| PSIPRED ccHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEEEEccccccccccHHHccccccHHHcccccEEEEEEEEcccccccccccccccccccEEEEEEEEEEcccccEEEcccccccccccccccHHHHHHHHccccHHEEccccHHHHHHHHHHHHHHHHHHHHHHHHcc //