[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68892.1
DDBJ      :             putative glucitol-specific PTS enzyme III
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  76/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.161.1
:123 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->120 2f9hA1 b.161.1.1 * 3.3e-28 39.0 %
:RPS:PFM   1->107 PF03829 * PTSIIA_gutA 7e-19 47.6 %
:HMM:PFM   2->111 PF03829 * PTSIIA_gutA 4.5e-32 37.0 108/117  
:BLT:SWISS 1->107 PTHA_SHIFL 4e-15 41.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68892.1 GT:GENE ACF68892.1 GT:PRODUCT putative glucitol-specific PTS enzyme III GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2864248..2864619 GB:FROM 2864248 GB:TO 2864619 GB:DIRECTION + GB:PRODUCT putative glucitol-specific PTS enzyme III GB:NOTE identified by match to protein family HMM PF03829 GB:PROTEIN_ID ACF68892.1 GB:DB_XREF GI:194408673 LENGTH 123 SQ:AASEQ MIYCARITAIGLFVADGLTDKMLITFDSNGPKDCLDYSLSLEPSFREESLMILPGDRLLLAGHDYLVTAVGKGVQQALFELGHLTLVFDGDLKPCHTGAIHLSGPVPKLHDLHGNLVIEEGRP GT:EXON 1|1-123:0| BL:SWS:NREP 1 BL:SWS:REP 1->107|PTHA_SHIFL|4e-15|41.9|105/123| RP:PFM:NREP 1 RP:PFM:REP 1->107|PF03829|7e-19|47.6|105/117|PTSIIA_gutA| HM:PFM:NREP 1 HM:PFM:REP 2->111|PF03829|4.5e-32|37.0|108/117|PTSIIA_gutA| GO:PFM:NREP 3 GO:PFM GO:0005737|"GO:cytoplasm"|PF03829|IPR004716| GO:PFM GO:0008982|"GO:protein-N(PI)-phosphohistidine-sugar phosphotransferase activity"|PF03829|IPR004716| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF03829|IPR004716| HM:SCP:REP 1->120|2f9hA1|3.3e-28|39.0|118/0|b.161.1.1|1/1|PTSIIA/GutA-like| OP:NHOMO 85 OP:NHOMOORG 76 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------1-11-----------------------------------------------------------------------11------------------------------------------11111-1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------12----------------------------------------1------1111111111-11111-111111211111-323-1---111111112111211111111111--1--------------------------------1--------111------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 122-124| PSIPRED cEEEEEEEEEccHHHHHHHccEEEEEcccccHHHHcEEEEEcccccccccccccccEEEEccEEEEEEEcHHHHHHHHHHccEEEEEEEccccccccccEEEccccccccccccEEEEEcccc //