[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68896.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  55/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:60 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   23->60 PF10636 * hemP 3e-09 63.2 %
:HMM:PFM   23->60 PF10636 * hemP 1.3e-19 55.3 38/38  
:BLT:SWISS 2->60 YDIE_ECOLI 5e-17 62.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68896.1 GT:GENE ACF68896.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1430093..1430275) GB:FROM 1430093 GB:TO 1430275 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF68896.1 GB:DB_XREF GI:194408677 LENGTH 60 SQ:AASEQ MDNTELPHPKEIDNETLLPAAERRVNSQALLGPDGKVIIDHNGQEYLLRKTQAGKLLLTK GT:EXON 1|1-60:0| BL:SWS:NREP 1 BL:SWS:REP 2->60|YDIE_ECOLI|5e-17|62.7|59/63| RP:PFM:NREP 1 RP:PFM:REP 23->60|PF10636|3e-09|63.2|38/38|hemP| HM:PFM:NREP 1 HM:PFM:REP 23->60|PF10636|1.3e-19|55.3|38/38|hemP| OP:NHOMO 55 OP:NHOMOORG 55 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-1111111-11-1111111111111111111111-----1111111111111111-111-111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-28| PSIPRED ccccccccccccccccccccccccccHHHHHccccEEEEEEcccEEEEEEccccEEEEEc //