[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68910.1
DDBJ      :             EpaQ
Swiss-Prot:SPAQ_SALTY   RecName: Full=Surface presentation of antigens protein spaQ;

Homologs  Archaea  0/68 : Bacteria  51/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:86 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   2->77 PF01313 * Bac_export_3 6e-09 40.8 %
:HMM:PFM   4->76 PF01313 * Bac_export_3 1.3e-28 49.3 73/76  
:BLT:SWISS 1->86 SPAQ_SALTY 1e-37 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68910.1 GT:GENE ACF68910.1 GT:PRODUCT EpaQ GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(3007899..3008159) GB:FROM 3007899 GB:TO 3008159 GB:DIRECTION - GB:PRODUCT EpaQ GB:NOTE identified by match to protein family HMM PF01313; match to protein family HMM TIGR01403 GB:PROTEIN_ID ACF68910.1 GB:DB_XREF GI:194408691 LENGTH 86 SQ:AASEQ MDDLVFAGNKALYLVLILSGWPTIVATIIGLLVGLFQTVTQLQEQTLPFGIKLLGVCLCLFLLSGWYGEVLLSYGRQVIFLALAKG GT:EXON 1|1-86:0| SW:ID SPAQ_SALTY SW:DE RecName: Full=Surface presentation of antigens protein spaQ; SW:GN Name=spaQ; OrderedLocusNames=STM2889; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane; Virulence. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->86|SPAQ_SALTY|1e-37|100.0|86/86| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0009405|"GO:pathogenesis"|Virulence| TM:NTM 2 TM:REGION 13->35| TM:REGION 46->68| SEG 53->63|llgvclclfll| RP:PFM:NREP 1 RP:PFM:REP 2->77|PF01313|6e-09|40.8|76/76|Bac_export_3| HM:PFM:NREP 1 HM:PFM:REP 4->76|PF01313|1.3e-28|49.3|73/76|Bac_export_3| GO:PFM:NREP 2 GO:PFM GO:0009306|"GO:protein secretion"|PF01313|IPR002191| GO:PFM GO:0016020|"GO:membrane"|PF01313|IPR002191| OP:NHOMO 52 OP:NHOMOORG 51 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-----1111-1------------------------------1-------------------------1111---------------------------------------------1-----------------------------------------------1-11-----11-11-1------1-1--------------1111111111111111--111--12-1-------------1------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //