[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68915.1
DDBJ      :             membrane protein YebN
Swiss-Prot:YEBN_SALHS   RecName: Full=UPF0059 membrane protein yebN;

Homologs  Archaea  11/68 : Bacteria  226/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:188 amino acids
:PSIPRED
:RPS:PFM   13->80 PF02659 * DUF204 9e-06 41.2 %
:RPS:PFM   116->166 PF02659 * DUF204 3e-06 54.9 %
:HMM:PFM   13->81 PF02659 * DUF204 2.5e-23 40.3 67/67  
:HMM:PFM   115->178 PF02659 * DUF204 1.1e-20 46.9 64/67  
:BLT:SWISS 1->188 YEBN_SALHS 1e-87 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68915.1 GT:GENE ACF68915.1 GT:PRODUCT membrane protein YebN GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1979952..1980518 GB:FROM 1979952 GB:TO 1980518 GB:DIRECTION + GB:PRODUCT membrane protein YebN GB:NOTE identified by match to protein family HMM PF02659 GB:PROTEIN_ID ACF68915.1 GB:DB_XREF GI:194408696 LENGTH 188 SQ:AASEQ MHYTATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGLGILASKFVLEWNHWIAFVLLIFLGGRMIIEGIRGGSDEDETPLRRHSFWLLVTTAIATSLDAMAVGVGLAFLQVNIIATALAIGCATLIMSTLGMMIGRFIGPMLGKRAEILGGVVLIGIGVQILWTHFHG GT:EXON 1|1-188:0| SW:ID YEBN_SALHS SW:DE RecName: Full=UPF0059 membrane protein yebN; SW:GN Name=yebN; OrderedLocusNames=SeHA_C2035; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane;Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->188|YEBN_SALHS|1e-87|100.0|188/188| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 6 TM:REGION 5->27| TM:REGION 40->62| TM:REGION 70->92| TM:REGION 105->127| TM:REGION 138->160| TM:REGION 166->188| SEG 81->92|ggrmiiegirgg| SEG 168->182|ilggvvligigvqil| RP:PFM:NREP 2 RP:PFM:REP 13->80|PF02659|9e-06|41.2|64/65|DUF204| RP:PFM:REP 116->166|PF02659|3e-06|54.9|51/65|DUF204| HM:PFM:NREP 2 HM:PFM:REP 13->81|PF02659|2.5e-23|40.3|67/67|DUF204| HM:PFM:REP 115->178|PF02659|1.1e-20|46.9|64/67|DUF204| OP:NHOMO 240 OP:NHOMOORG 238 OP:PATTERN ---------------------------------11--------11111--111-----------1--- -------1111---------------------------------2--------------------------1---111111-------1111-1-----------------------------------------------11----11-111----------1--------------------------11--11111111-111111------11-----1--------1---------------------------------------------------------------------------------------------1--1111111-1-1----1111-1----1--11----1-1------1-----------------1----1--1--------------------1----------------11------------11111111-------------------------------------------------------------1------------------------1---------1----1-11111-1-------111111-111--1-1----1------1-11111111111-----------2----------11------------------------------------1111-111111111111-11111111111111111111111111111111111111111111-1111111-111111111111---1----------1-1----1-1-----------------11--11-1-1----1---111------------------------11111111111111----------------------------------------------------------1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //