[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68928.1
DDBJ      :             transketolase domain protein
Swiss-Prot:             

Homologs  Archaea  38/68 : Bacteria  864/915 : Eukaryota  190/199 : Viruses  0/175   --->[See Alignment]
c.36.1
:276 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->258 1qgdA PDBj 2e-30 34.4 %
:RPS:PDB   5->263 2e6kA PDBj 1e-29 29.2 %
:RPS:SCOP  4->253 1ay0A1  c.36.1.10 * 6e-60 34.7 %
:HMM:SCOP  3->262 1l8aA1 c.36.1.10 * 4.2e-74 38.7 %
:RPS:PFM   9->252 PF00456 * Transketolase_N 7e-42 39.5 %
:HMM:PFM   8->257 PF00456 * Transketolase_N 2.9e-57 34.5 249/333  
:BLT:SWISS 1->266 TKTN_METJA 1e-40 35.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68928.1 GT:GENE ACF68928.1 GT:PRODUCT transketolase domain protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2498867..2499697) GB:FROM 2498867 GB:TO 2499697 GB:DIRECTION - GB:PRODUCT transketolase domain protein GB:NOTE identified by match to protein family HMM PF00456 GB:PROTEIN_ID ACF68928.1 GB:DB_XREF GI:194408709 LENGTH 276 SQ:AASEQ MNVTEITQLARDIRVATLKSLNHLGFGHYGGSMSVVETLAVLYGAVMKIDPADPDWPERDYFVLSKGHAGPALYSTLAIKGYFPREELNTLNQNGTRLPSHPDRLKTRGVDATTGSLGQGISIAGGMALSHKLARRPNRVFCIVGDGELNEGQCWEAFQFIAHHRLNNLTVFIDWNKQQLDGELEEIINPFDLEGKFRAFGFDVVTVKGDDIAGLLAVVQPVPPADAQPRVVILDSIKGQGVPCLEQLTNSHHLRLTDGMKQTLNEAIHQLEVMHD GT:EXON 1|1-276:0| BL:SWS:NREP 1 BL:SWS:REP 1->266|TKTN_METJA|1e-40|35.1|265/274| SEG 217->232|avvqpvppadaqprvv| BL:PDB:NREP 1 BL:PDB:REP 8->258|1qgdA|2e-30|34.4|250/662| RP:PDB:NREP 1 RP:PDB:REP 5->263|2e6kA|1e-29|29.2|253/632| RP:PFM:NREP 1 RP:PFM:REP 9->252|PF00456|7e-42|39.5|243/275|Transketolase_N| HM:PFM:NREP 1 HM:PFM:REP 8->257|PF00456|2.9e-57|34.5|249/333|Transketolase_N| RP:SCP:NREP 1 RP:SCP:REP 4->253|1ay0A1|6e-60|34.7|245/335|c.36.1.10| HM:SCP:REP 3->262|1l8aA1|4.2e-74|38.7|256/415|c.36.1.10|1/1|Thiamin diphosphate-binding fold (THDP-binding)| OP:NHOMO 1958 OP:NHOMOORG 1092 OP:PATTERN 11-1--1111111111-111111------1-----11111111-----------11-111-111--11 1242421111111212222-2211352222232111327711121231211274522211433133544411111111311111111111121111--11111211131311111111111111122112212122122221121122221131111111111111122122121121111112111111-11122222122122222231221122111111113444331211111111111111111111-11----1--123--1--1-1111112321122-11322223323231111111111111111111222321127111111131312111111112112121111111121112111-12131222211111315561132333411111111114-22323422231122212333324427221122323412211111111432112421111111111---------------111121121121111444242222222242222222113223211111431112441321121111222222222112112-212-1111131111233222321113112112112111111111111111121111221172112222222222223222222222221-2221211111132323423334344433-3333344333343333335565322124333333333333333223233331122122222222211211111111113223111132111111111222222111113111111123111221221111111111133333333333433111111111111111131111122--------111----1-11121111111121111111211113121111 11--211-311112122224241333511-11111111111111112122234312211111113111111223222-2211111111-2422232545211122211322452221221223233242DL3-43222214225-2232131141112211-11111411511212111I1111142342222221111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 263 STR:RPRED 95.3 SQ:SECSTR HHHHHHHHHHHHHHHHHHHHHHHHTccccHHHHHHHHHHHHHHHHTTcccTTcTTcTTccEEEEccGGGHHHHHHHHHTTccccHHHHTTTTcTTcccccccccTTcTTcccccccTTHHHHHHHHHHHHHHHHHHHccEEEEEcHHHHHcHHHHHHHHHHHHTTcTTEEEEEEEccEETTEEGGGTcccccHHHHHHHTTcEEEEEccTTcHHHHHHHHHHHHHccccEEEEEEccTTTTcTTTTcGGGTccccHHHHHHHH############# DISOP:02AL 1-1,274-277| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccccccEEEEccccHHHHHHHHHHHcccccHHHHHHHHcccccccccccccccccEEccccHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHcccccEEEEEEcccccccccHHHHHccHHHHHHHHHccccEEEcccccHHHHHHHHHHHHHcccccEEEEEEccccccccHHccccHHccccccHHHHHHHHHHHHHcccccc //