[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68932.1
DDBJ      :             conserved domain protein
Swiss-Prot:LPP2_SALTI   RecName: Full=Major outer membrane lipoprotein 2;AltName: Full=Murein-lipoprotein 2;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  83/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
h.1.16
:79 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->72 1eq7A PDBj 9e-22 94.0 %
:HMM:SCOP  23->73 1jccA_ h.1.16.1 * 1.5e-19 68.6 %
:HMM:PFM   25->35 PF04728 * LPP 7.3e-06 72.7 11/11  
:HMM:PFM   40->49 PF04728 * LPP 0.00013 90.0 10/11  
:BLT:SWISS 1->79 LPP2_SALTI 6e-37 93.7 %
:COIL
:REPEAT 2|25->38|39->52

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68932.1 GT:GENE ACF68932.1 GT:PRODUCT conserved domain protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1464249..1464488) GB:FROM 1464249 GB:TO 1464488 GB:DIRECTION - GB:PRODUCT conserved domain protein GB:NOTE identified by match to protein family HMM PF04728 GB:PROTEIN_ID ACF68932.1 GB:DB_XREF GI:194408713 LENGTH 79 SQ:AASEQ MTRTNKLILGAAVLGSTLLTGCSSNAGIDQLSSDVQTLSAKVEQLSNDVNAMRSDVQAAKDDAARANQRLDNKVFRICK GT:EXON 1|1-79:0| SW:ID LPP2_SALTI SW:DE RecName: Full=Major outer membrane lipoprotein 2;AltName: Full=Murein-lipoprotein 2;Flags: Precursor; SW:GN Name=lpp2; Synonyms=lppB; OrderedLocusNames=STY1746, t1244; SW:KW Cell membrane; Cell outer membrane; Complete proteome; Lipoprotein;Membrane; Palmitate; Peptidoglycan-anchor; Repeat; Signal. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->79|LPP2_SALTI|6e-37|93.7|79/79| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0009279|"GO:cell outer membrane"|Cell outer membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| COIL:NAA 55 COIL:NSEG 1 COIL:REGION 23->77| NREPEAT 1 REPEAT 2|25->38|39->52| BL:PDB:NREP 1 BL:PDB:REP 23->72|1eq7A|9e-22|94.0|50/56| HM:PFM:NREP 2 HM:PFM:REP 25->35|PF04728|7.3e-06|72.7|11/11|LPP| HM:PFM:REP 40->49|PF04728|0.00013|90.0|10/11|LPP| HM:SCP:REP 23->73|1jccA_|1.5e-19|68.6|51/0|h.1.16.1|1/1|Outer membrane lipoprotein| OP:NHOMO 134 OP:NHOMOORG 83 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------11111112222222122-2222222222222222221111111111123222223122233122222221111-11111-11111------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 50 STR:RPRED 63.3 SQ:SECSTR ######################cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH####### DISOP:02AL 1-3| PSIPRED cccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //