[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68958.1
DDBJ      :             conserved domain protein
Swiss-Prot:YCIG_ECOLI   RecName: Full=Uncharacterized protein yciG;

Homologs  Archaea  0/68 : Bacteria  64/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:60 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->31 PF10685 * KGG 1.1e-12 68.2 22/23  
:HMM:PFM   32->53 PF10685 * KGG 5.7e-14 59.1 22/23  
:BLT:SWISS 1->43 YCIG_ECOLI 8e-21 95.3 %
:REPEAT 2|9->29|31->51

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68958.1 GT:GENE ACF68958.1 GT:PRODUCT conserved domain protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1873368..1873550 GB:FROM 1873368 GB:TO 1873550 GB:DIRECTION + GB:PRODUCT conserved domain protein GB:PROTEIN_ID ACF68958.1 GB:DB_XREF GI:194408739 LENGTH 60 SQ:AASEQ MAEHRGGSGNFAENREKASEAGRKGGQHSGGNFKNDPQRASEAGKKGGQNSHGGRKSDNS GT:EXON 1|1-60:0| SW:ID YCIG_ECOLI SW:DE RecName: Full=Uncharacterized protein yciG; SW:GN Name=yciG; OrderedLocusNames=b1259, JW1251; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->43|YCIG_ECOLI|8e-21|95.3|43/59| NREPEAT 1 REPEAT 2|9->29|31->51| HM:PFM:NREP 2 HM:PFM:REP 10->31|PF10685|1.1e-12|68.2|22/23|KGG| HM:PFM:REP 32->53|PF10685|5.7e-14|59.1|22/23|KGG| OP:NHOMO 117 OP:NHOMOORG 64 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---2-222-212-21-222211121321222222-322------233323222333332----111----------------------------------------------------------1-2132-1--111111---------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-61| PSIPRED ccccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccccccc //