[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68967.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:82 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->58 PF08883 * DOPA_dioxygen 0.00072 21.7 46/104  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68967.1 GT:GENE ACF68967.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 3097317..3097565 GB:FROM 3097317 GB:TO 3097565 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF68967.1 GB:DB_XREF GI:194408748 LENGTH 82 SQ:AASEQ MQLLLGRLLCTLHAFIHWQEKYKKRATHTHRATTQYFGDELRLFMAKAQDSGSHFTEMKSEGVGVDAGGIKREECETGRLIT GT:EXON 1|1-82:0| HM:PFM:NREP 1 HM:PFM:REP 13->58|PF08883|0.00072|21.7|46/104|DOPA_dioxygen| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--1---1-1----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccccHHHHHcccccc //