[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF68976.1
DDBJ      :             putative inner membrane protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.1.8
:516 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  381->457 1aq0A  c.1.8.3 * 5e-04 29.6 %
:RPS:PFM   71->135 PF09913 * DUF2142 1e-04 46.0 %
:HMM:PFM   90->200 PF11028 * DUF2723 0.00043 26.1 111/178  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68976.1 GT:GENE ACF68976.1 GT:PRODUCT putative inner membrane protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1774978..1776528 GB:FROM 1774978 GB:TO 1776528 GB:DIRECTION + GB:PRODUCT putative inner membrane protein GB:PROTEIN_ID ACF68976.1 GB:DB_XREF GI:194408757 LENGTH 516 SQ:AASEQ MALPQLSIWQPGDGLRKIKYKYHVCLIVIFSVLIRLLFLTDRYLWCDEASSVLISRHSVDNLLFHAAFDVHPPLYYLLLHDWIILWGDSIAAVRSLSLLFGILTVVLVIALTRWLANERTALLAGWFAALMPMAVHYSQETRMYALMGMLTLAAALALMMWIKTPTHNRYLVAYALLMTFSFYTHYFTLFTLIAHWIAVTILSCQSHKTACYLKLPGWWFANLAIAVAYLPWLPVLFNLLTHLAQLRAGNDIGWIPPVTWRDLPAMYWHFFTGNNGQGFPSFILWLAVGGFIGTVGRISLCNGEYERYQLILFCNLVIPVMLVFIISWWMPLFIDRYFFFSSLSIPPLLAVLLTRAKKAVCGFWFILFTLLFGYGSYHNNPEHIDEFKPLVNYINTRHQPNDAVVVSKMFDYLSYVYYNKRDYRTFLYTPPNAHGTSGRPNAYGFGSLFYAQADQTYIDTLTTLSKSYHRVWLVSGGNFSQDYPLPSEWQNIAKFRSGRFQVQLFVIPTQQARQMQ GT:EXON 1|1-516:0| TM:NTM 10 TM:REGION 21->43| TM:REGION 72->94| TM:REGION 96->118| TM:REGION 144->163| TM:REGION 185->205| TM:REGION 220->242| TM:REGION 279->301| TM:REGION 309->331| TM:REGION 334->355| TM:REGION 359->381| SEG 143->160|myalmgmltlaaalalmm| RP:PFM:NREP 1 RP:PFM:REP 71->135|PF09913|1e-04|46.0|63/382|DUF2142| HM:PFM:NREP 1 HM:PFM:REP 90->200|PF11028|0.00043|26.1|111/178|DUF2723| RP:SCP:NREP 1 RP:SCP:REP 381->457|1aq0A|5e-04|29.6|71/306|c.1.8.3| OP:NHOMO 32 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------1--1--1----111----------- --1---------------------------------------12-----------------------------------------------------------------------------------------------11------1--11------------------1-----------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------1-1-11-111-111-1------------------------------------------------------------------------111---------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,6-6,512-517| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcHHHHcccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHcccccccEEEEEEcccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHHHcccccEEEEEEccccccccccccccccccEEEEEcccEEEEHHcccccccEEEEEEEEcccccccccccHHHHHHHHHHcccEEEEEEEEccHHHHccc //