[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69009.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:51 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->47 PF03904 * DUF334 0.00035 28.2 39/230  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69009.1 GT:GENE ACF69009.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1718161..1718316 GB:FROM 1718161 GB:TO 1718316 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF69009.1 GB:DB_XREF GI:194408790 LENGTH 51 SQ:AASEQ MDTFEKIRQADCRAGGTWDFGLQTEIGSENLLATRRQNSGVLKFLTPAQRV GT:EXON 1|1-51:0| HM:PFM:NREP 1 HM:PFM:REP 9->47|PF03904|0.00035|28.2|39/230|DUF334| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,50-52| PSIPRED ccHHHHHHHHHHcccccccccEEEcccccHHHHHHcccccEEEEccHHHcc //