[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69035.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  68/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->91 PF07383 * DUF1496 7e-29 75.6 %
:HMM:PFM   1->90 PF07383 * DUF1496 8.7e-36 47.1 87/88  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69035.1 GT:GENE ACF69035.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1385263..1385538 GB:FROM 1385263 GB:TO 1385538 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF07383 GB:PROTEIN_ID ACF69035.1 GB:DB_XREF GI:194408816 LENGTH 91 SQ:AASEQ MRRSLVVAVMAIMPMVGLANQNSRPDIQVNVPPEVFSTRGQSSQPCIQCCVYQDQNYSEGAVIKVEGVLLQCQRDEKTISTNPLVWRRVKP GT:EXON 1|1-91:0| TM:NTM 1 TM:REGION 4->22| RP:PFM:NREP 1 RP:PFM:REP 5->91|PF07383|7e-29|75.6|86/90|DUF1496| HM:PFM:NREP 1 HM:PFM:REP 1->90|PF07383|8.7e-36|47.1|87/88|DUF1496| OP:NHOMO 68 OP:NHOMOORG 68 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111-111111-1--1--111111---11----11111111111111111111111--111111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHHccccccEEEEEccccEEEEEEccccccEEEEEEEccccccccEEEEccEEEEEEEcccccccccEEEEEccc //