[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69044.1
DDBJ      :             conserved domain protein
Swiss-Prot:YBDD_SHIFL   RecName: Full=Uncharacterized protein ybdD;

Homologs  Archaea  0/68 : Bacteria  165/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:65 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->65 PF04328 * DUF466 1e-23 73.8 %
:HMM:PFM   1->65 PF04328 * DUF466 2e-35 63.1 65/65  
:BLT:SWISS 1->65 YBDD_SHIFL 1e-34 90.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69044.1 GT:GENE ACF69044.1 GT:PRODUCT conserved domain protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 711873..712070 GB:FROM 711873 GB:TO 712070 GB:DIRECTION + GB:PRODUCT conserved domain protein GB:NOTE identified by match to protein family HMM PF04328 GB:PROTEIN_ID ACF69044.1 GB:DB_XREF GI:194408825 LENGTH 65 SQ:AASEQ MFDTLSKAGKYLGQAAKMMIGVPDYDNYVEHMRITHPDQTPMTYEEFFRERQDARYGGKGGARCC GT:EXON 1|1-65:0| SW:ID YBDD_SHIFL SW:DE RecName: Full=Uncharacterized protein ybdD; SW:GN Name=ybdD; OrderedLocusNames=SF0513, S0518.1; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->65|YBDD_SHIFL|1e-34|90.8|65/65| RP:PFM:NREP 1 RP:PFM:REP 1->65|PF04328|1e-23|73.8|65/65|DUF466| HM:PFM:NREP 1 HM:PFM:REP 1->65|PF04328|2e-35|63.1|65/65|DUF466| OP:NHOMO 221 OP:NHOMOORG 165 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111-111111------111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------11---------------------1----------------------------------------------1--------------------------------2-------11-11-1----11-21111-111-1111--111-11-----11---1-----1-------1-1-----------------------------------------------1---------------------------------------------------------22111212112222-22-222222222222222222222211--1222222222222222212222122---11111111111---------------------------------1111111---1-11111111-1111-111------------------------1111-11111--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccccc //