[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69066.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  38/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:42 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   14->37 PF09578 * Spore_YabQ 0.00027 41.7 24/80  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69066.1 GT:GENE ACF69066.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1855797..1855925) GB:FROM 1855797 GB:TO 1855925 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF69066.1 GB:DB_XREF GI:194408847 LENGTH 42 SQ:AASEQ MPSENQEPRRDPELKRKAWLAVFVGSALFWVVVALVIWHWWG GT:EXON 1|1-42:0| TM:NTM 1 TM:REGION 18->40| HM:PFM:NREP 1 HM:PFM:REP 14->37|PF09578|0.00027|41.7|24/80|Spore_YabQ| OP:NHOMO 38 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-1-11-11-1--1111111111111111-----------11--11-1111----1--111-11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-15| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //