[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69075.1
DDBJ      :             phage minor tail protein G
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:132 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->111 PF06894 * Phage_lambd_GpG 1e-17 45.2 %
:HMM:PFM   1->122 PF06894 * Phage_lambd_GpG 3e-49 48.7 115/127  
:BLT:SWISS 1->129 VMTG_LAMBD 1e-08 32.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69075.1 GT:GENE ACF69075.1 GT:PRODUCT phage minor tail protein G GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1130123..1130521 GB:FROM 1130123 GB:TO 1130521 GB:DIRECTION + GB:PRODUCT phage minor tail protein G GB:NOTE identified by match to protein family HMM PF06894; match to protein family HMM TIGR01674 GB:PROTEIN_ID ACF69075.1 GB:DB_XREF GI:194408856 LENGTH 132 SQ:AASEQ MFLKKETFTRGDASVALFELSGLQRIEYLEFIQKRTAKYDTDMDGATEADKRVAYMQMALEINAWLVSRSLLNGDSSQDADTLYQSVQAKWSYEALDAGAESVLMLSGLSADKKDNASDSGNESEDMTPEKS GT:EXON 1|1-132:0| BL:SWS:NREP 1 BL:SWS:REP 1->129|VMTG_LAMBD|1e-08|32.8|119/100| RP:PFM:NREP 1 RP:PFM:REP 1->111|PF06894|1e-17|45.2|104/118|Phage_lambd_GpG| HM:PFM:NREP 1 HM:PFM:REP 1->122|PF06894|3e-49|48.7|115/127|Phage_lambd_GpG| OP:NHOMO 29 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--1-1---1----1--11111-----1----------1-11-21-1-2--2-1--212------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 113-133| PSIPRED cccccccEEEccEEEEHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHccccccccccccccccccc //