[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69092.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:476 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 349->432 RNH2_PYRFU 6e-04 29.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69092.1 GT:GENE ACF69092.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2554020..2555450) GB:FROM 2554020 GB:TO 2555450 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF69092.1 GB:DB_XREF GI:194408873 LENGTH 476 SQ:AASEQ MQVKKKRNYNRLKLVYTKYVFYCAYYCPILFPRWLVNEVNSRHEETGSLNNYINNDNPKFVSFLNGEFNWYKTTLSFIIEKNELDKLAKWIIRYSRSTFNASRYEGINDVSNIFGSSYFNFGKISVNGNDRGISDSLKPLSSKTKYIDFIMLSLHKHGSDLFIMTYEVFMKKGATDAIKNITVDELVFDSEFDKLNFYSKKNSGFRCWDRSWLASEIICEKFDIVFSDVHKVLKELNDTIGMSIHENSVVAIPEMCIEEHVDYFSGTNNQNAERAAEFGYYYPSPYLIKDEGGYLLNIHNTSKYSFDALYIYNKVNKKNNNGYPDFYPTTNSKGFIRDISFGLLISNGITTLAKQVGEVVTDEHGDVLTQKHNDYFIFYMRSKKIKSWLEAFSRKRNTKVNNLLKYQVEKCDELVRKTESLYHLSESRIQFDSIKYNKKNSKIIFWFVIIQIILAVLAIDIQKWKIWLNWVVNFFN GT:EXON 1|1-476:0| BL:SWS:NREP 1 BL:SWS:REP 349->432|RNH2_PYRFU|6e-04|29.1|79/100| TM:NTM 2 TM:REGION 18->40| TM:REGION 441->462| SEG 313->321|nkvnkknnn| SEG 433->462|sikynkknskiifwfviiqiilavlaidiq| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8| PSIPRED ccccccccccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccccccccEEEEEcccccEEEEEEEEEEEHHHHHHHHHHHHHHccccccHHHHcccHHHHHHHccccccEEEEEEcccccccccccccccccccHHEEEEEEEcccccEEEEEEEHHHHHccccHHHHcccHHHEEEcccccccEEEEcccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEccccEEccHHHHHHHHHHHHcccccccHHHHHHccccccccEEEEEcccEEEEEEccccccEEEEEEEEcccccccccccccccccccccEEEEEEEEEEEcccHHHHHHHHHHHHHcccccEEEEccccEEEEEEEcHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccccEEEEHHHHHHHHHHHHHEEHHHHHHHHHHHHHHcc //