[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69127.1
DDBJ      :             ABC nickel/di-oligopepetide transporter, ATP binding subunit
Swiss-Prot:             

Homologs  Archaea  63/68 : Bacteria  838/915 : Eukaryota  40/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:265 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->242 3fvqB PDBj 6e-12 27.4 %
:RPS:PDB   1->49 2d3wC PDBj 6e-05 35.0 %
:RPS:PDB   24->241 3b5jA PDBj 3e-22 23.7 %
:RPS:SCOP  1->224 1ji0A  c.37.1.12 * 3e-20 18.4 %
:HMM:SCOP  7->237 1g6hA_ c.37.1.12 * 7.8e-44 36.9 %
:HMM:PFM   50->175 PF00005 * ABC_tran 3.2e-12 27.6 116/118  
:HMM:PFM   28->58 PF03193 * DUF258 0.00037 36.7 30/161  
:BLT:SWISS 2->233 NIKD_SHIFL 1e-21 31.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69127.1 GT:GENE ACF69127.1 GT:PRODUCT ABC nickel/di-oligopepetide transporter, ATP binding subunit GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1347568..1348365 GB:FROM 1347568 GB:TO 1348365 GB:DIRECTION + GB:PRODUCT ABC nickel/di-oligopepetide transporter, ATP binding subunit GB:NOTE identified by match to protein family HMM PF00005 GB:PROTEIN_ID ACF69127.1 GB:DB_XREF GI:194408908 LENGTH 265 SQ:AASEQ MLSLQQVTLESARYRWYGTRRWSPLLQNVSFDIAPGEMVALVGGSGEGKSLLLQCLLDLLPENLRFRGEITLDGNRLDRHTIRQLRGNTFSYVPQGVQALNPMLNIRKHLNRACHLTGRAWDETQMVQLLQQSDLEPTVLERFPRQLSGGMAKRILACHASLSQARYIFADEITAWLDTALANQLLEHLRGLCGRGCGVLWVTHDLLLAARYADRIVALHQGYITDNIRCEQLQPEKMSEPLKRQWQALPELNPLFMPTGEGIEC GT:EXON 1|1-265:0| BL:SWS:NREP 1 BL:SWS:REP 2->233|NIKD_SHIFL|1e-21|31.4|220/254| SEG 51->64|lllqclldllpenl| SEG 189->198|lrglcgrgcg| BL:PDB:NREP 1 BL:PDB:REP 23->242|3fvqB|6e-12|27.4|215/350| RP:PDB:NREP 2 RP:PDB:REP 1->49|2d3wC|6e-05|35.0|40/241| RP:PDB:REP 24->241|3b5jA|3e-22|23.7|207/243| HM:PFM:NREP 2 HM:PFM:REP 50->175|PF00005|3.2e-12|27.6|116/118|ABC_tran| HM:PFM:REP 28->58|PF03193|0.00037|36.7|30/161|DUF258| RP:SCP:NREP 1 RP:SCP:REP 1->224|1ji0A|3e-20|18.4|212/240|c.37.1.12| HM:SCP:REP 7->237|1g6hA_|7.8e-44|36.9|222/254|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 6516 OP:NHOMOORG 941 OP:PATTERN 445-533188887774653223255335716-23--11111116263A35HF61785322446-5112 3313R67477846243322-24114822222242225GAF29399BB99763BG9536229947E7CDBH66444D77839142-323---1----5----1--1123-212222222321111313223111234577982228445354433333121-114115844411211111111142443BC-647DEEDECGG9FFHEDILFBBGBIFF75BOD76799899YF8AAACAAAAAAAAAA7778696779A754458844A85626655778895768A88777655565665555555565565A5355566684HB9878788A888757553566D6225A5513NLC2-14G3246A5269524311-3454463WPb367ACBG5EFGFFFGBGFc-33D43C5Cbc4-*bbmYWOqqfZYXA321BHQICEICML222222223773122H11-1----11-------1-11----1-1--22511HMHBDBCCDDB6777799FK988969AAP88EF1278C83967B9R9Ta483453276443333351223358A1565A34588B-433223341332277441331111111-2313122231621233C852626141C22443336322433754431-23532------A7VK7GCAAABAC9CAA-AAAAABAA8AABA9AAAA9GKIML7887566666666766667IA98BB9A3-FDDDCDCDDCCD--3233223333312G7F45315243343522634334123379466667FEK8BC875IKM-111-111157DDA88888BGBGG5522122122-------5443333111-11-191141341--1-12-1222---3-1---65D95FLFCE244 -----------------1------------------------------121111-1-------------1--1-----------1---------------1-11------1-----4-1-----11-2--------------1-1-----1-----1-41---2-2--11-32-2----821--1---2--1--2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 265 STR:RPRED 100.0 SQ:SECSTR cEEccccccccccEEccccHHHHEEEEEEEEEEETTcEEEEEccTTccHHHHHHHHTTccccTEEcEEEEEETTEETTTccHHHHHHHHEEEEccccccTTccHHHHHcTTcTTccHHHHHHHHHHHTcHHHHHTcTccccTTTTcccHHHHHHHHHHHHHTTcccEEEEccccccccHHHHHHHHHHHHHHHHTTcEEEEEcccGGGGGTTccEEEEEETTEEHHHHHEEEEcHHHHHcTHTcTTcEEETTTcccHHHHHHHHc DISOP:02AL 253-266| PSIPRED ccEEccEEEEEEEEEEEccccEEEEEccccEEEccccEEEEEccccccHHHHHHHHHHccccccEEEEEEEEccEEccHHHHHHHHHHHEEEEccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHccHHccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHcccEEEEEccEEEEEccHHHHHHccccHHHHHHHHHccccccccccccccccc //