[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69133.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:42 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   14->31 PF01479 * S4 0.00023 50.0 18/48  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69133.1 GT:GENE ACF69133.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1001665..1001793 GB:FROM 1001665 GB:TO 1001793 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF69133.1 GB:DB_XREF GI:194408914 LENGTH 42 SQ:AASEQ MTNFDYYSACKAKLDKVVYRVTFNSISEAIRNVSKGVNHDNE GT:EXON 1|1-42:0| HM:PFM:NREP 1 HM:PFM:REP 14->31|PF01479|0.00023|50.0|18/48|S4| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1-1--1111-11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,35-43| PSIPRED ccccHHHHHHHHHHHHHHHHEEHHHHHHHHHHHHHccccccc //