[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69137.1
DDBJ      :             peroxiredoxin OsmC
Swiss-Prot:OSMC_SHIFL   RecName: Full=Peroxiredoxin osmC;         EC=1.11.1.15;AltName: Full=Osmotically-inducible protein C;

Homologs  Archaea  0/68 : Bacteria  222/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.227.1
:143 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->143 1nyeE PDBj 2e-73 92.3 %
:RPS:PDB   2->142 3eerA PDBj 3e-27 25.4 %
:RPS:SCOP  1->143 1nyeA  d.227.1.1 * 4e-32 92.3 %
:HMM:SCOP  3->142 1ukkA_ d.227.1.1 * 1.5e-38 38.8 %
:RPS:PFM   42->137 PF02566 * OsmC 6e-13 38.3 %
:HMM:PFM   43->139 PF02566 * OsmC 1.5e-21 27.4 95/99  
:BLT:SWISS 1->143 OSMC_SHIFL 7e-73 92.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69137.1 GT:GENE ACF69137.1 GT:PRODUCT peroxiredoxin OsmC GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1693088..1693519) GB:FROM 1693088 GB:TO 1693519 GB:DIRECTION - GB:PRODUCT peroxiredoxin OsmC GB:NOTE identified by match to protein family HMM PF02566; match to protein family HMM TIGR03562 GB:PROTEIN_ID ACF69137.1 GB:DB_XREF GI:194408918 LENGTH 143 SQ:AASEQ MTIHKKGQAHWEGDIKRGKGTVSTESGVLNQQPYGFNTRFEGAQGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDTTADVSLDKVEAGFAITKIALQSKVAVADIDASTFDQIIQKAKAGCPVSQVLNAEITLDYQLNA GT:EXON 1|1-143:0| SW:ID OSMC_SHIFL SW:DE RecName: Full=Peroxiredoxin osmC; EC=1.11.1.15;AltName: Full=Osmotically-inducible protein C; SW:GN Name=osmC; OrderedLocusNames=SF1743, S1876; SW:KW Acetylation; Antioxidant; Complete proteome; Cytoplasm;Oxidoreductase; Peroxidase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->143|OSMC_SHIFL|7e-73|92.3|143/143| GO:SWS:NREP 5 GO:SWS GO:0016209|"GO:antioxidant activity"|Antioxidant| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0004601|"GO:peroxidase activity"|Peroxidase| BL:PDB:NREP 1 BL:PDB:REP 1->143|1nyeE|2e-73|92.3|143/151| RP:PDB:NREP 1 RP:PDB:REP 2->142|3eerA|3e-27|25.4|134/138| RP:PFM:NREP 1 RP:PFM:REP 42->137|PF02566|6e-13|38.3|94/99|OsmC| HM:PFM:NREP 1 HM:PFM:REP 43->139|PF02566|1.5e-21|27.4|95/99|OsmC| GO:PFM:NREP 1 GO:PFM GO:0006950|"GO:response to stress"|PF02566|IPR003718| RP:SCP:NREP 1 RP:SCP:REP 1->143|1nyeA|4e-32|92.3|143/143|d.227.1.1| HM:SCP:REP 3->142|1ukkA_|1.5e-38|38.8|139/141|d.227.1.1|1/1|OsmC-like| OP:NHOMO 239 OP:NHOMOORG 225 OP:PATTERN -------------------------------------------------------------------- 111-1------1------------------------11111---121----1111--1----2-1111221-----------1------------------2-1151111----------------------------------11-------------------------------------11111------11111111-111111------111----1-1---------------------------------------------------111----------------------------------------------------------------------------------------------1--1--1-----111----111111----------1-11-11-1-12--2--111-111--11-----11111---11111111-111---1------------------------------1--1--11---------------11--------1----------111111--1-1-----------------1--11---------------------1---------------------------------------1---122---------------------------------1----111111111111-111111111111111111111111---1111111111111111-1111111------------------------------1--------------------------1-1111-111111111111------------------------1111111111-------------------------------------------------------------1- ----21--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 143 STR:RPRED 100.0 SQ:SECSTR ccccccccEEEccTTTcTcEEEEETTcccEEEEEcccGGTcccccccHHHHHHHHHHHHHHHHHHHHHHHTTcccccccEEEEEEEEEcccccEEEEEEEEEEEEcccccHHHHHHHHHHHHHHcHHHHHHTTTcccEEEETc DISOP:02AL 1-3,35-45,143-144| PSIPRED ccEEEEEEEEEEcccEEccEEEEEccccEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHEEEEEEEEEEEcccccEEEEEEEEEEEEEccccHHHHHHHHHHHHHcccEEEEccccEEEEEEEEc //