[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69159.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:YODD_ECOLI   RecName: Full=Uncharacterized protein yodD;

Homologs  Archaea  0/68 : Bacteria  52/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:75 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   18->75 PF10733 * DUF2525 1e-18 96.6 %
:HMM:PFM   18->75 PF10733 * DUF2525 1.2e-39 87.9 58/58  
:BLT:SWISS 1->75 YODD_ECOLI 1e-35 92.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69159.1 GT:GENE ACF69159.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2116032..2116259 GB:FROM 2116032 GB:TO 2116259 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF69159.1 GB:DB_XREF GI:194408940 LENGTH 75 SQ:AASEQ MKTAKEYSDTAKREVSVDVDALLAAINEISESEVHRSQEDPERVSVDGREYHTWHELAEAFELDIHDFSVTEVNR GT:EXON 1|1-75:0| SW:ID YODD_ECOLI SW:DE RecName: Full=Uncharacterized protein yodD; SW:GN Name=yodD; OrderedLocusNames=b1953, JW5317; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->75|YODD_ECOLI|1e-35|92.0|75/75| RP:PFM:NREP 1 RP:PFM:REP 18->75|PF10733|1e-18|96.6|58/58|DUF2525| HM:PFM:NREP 1 HM:PFM:REP 18->75|PF10733|1.2e-39|87.9|58/58|DUF2525| OP:NHOMO 52 OP:NHOMOORG 52 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-1111111-11-1111111111111-11--1111-----1111111111111111--111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10,31-45,74-76| PSIPRED cccHHHHHHHHHHEEEEEHHHHHHHHHHccHHHHHHHcccccEEEEccHHHHHHHHHHHHHHHccccccHHHccc //