[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69257.1
DDBJ      :             bacteriophage lysis protein
Swiss-Prot:ENPP_BPP22   RecName: Full=Probable endopeptidase;         EC=3.4.-.-;AltName: Full=Protein gp15;

Homologs  Archaea  0/68 : Bacteria  61/915 : Eukaryota  0/199 : Viruses  14/175   --->[See Alignment]
:145 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   6->142 PF03245 * Phage_lysis 2e-32 63.5 %
:HMM:PFM   1->144 PF03245 * Phage_lysis 2e-59 52.1 144/153  
:BLT:SWISS 19->145 ENPP_BPP22 3e-67 95.3 %
:TM
:COIL

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69257.1 GT:GENE ACF69257.1 GT:PRODUCT bacteriophage lysis protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 393885..394322 GB:FROM 393885 GB:TO 394322 GB:DIRECTION + GB:PRODUCT bacteriophage lysis protein GB:NOTE identified by match to protein family HMM PF03245 GB:PROTEIN_ID ACF69257.1 GB:DB_XREF GI:194409038 LENGTH 145 SQ:AASEQ MSRLTAIISALVICIIVCLSWAVNHYRDNAIAYKDQRDKATSIIADMQKRQRDVAELDARYTKELADANATIESLRADVSAGRKRLQVSATCPKSTTGASGMGDGESPRLTADAELNYYRLRSGIDKITAQVNYLQDYIRTQCLK GT:EXON 1|1-145:0| SW:ID ENPP_BPP22 SW:DE RecName: Full=Probable endopeptidase; EC=3.4.-.-;AltName: Full=Protein gp15; SW:GN Name=15; SW:KW Antimicrobial; Bacteriolytic enzyme; Hydrolase; Periplasm; Protease. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 19->145|ENPP_BPP22|3e-67|95.3|127/145| GO:SWS:NREP 6 GO:SWS GO:0003824|"GO:catalytic activity"|Bacteriolytic enzyme| GO:SWS GO:0019835|"GO:cytolysis"|Bacteriolytic enzyme| GO:SWS GO:0042742|"GO:defense response to bacterium"|Bacteriolytic enzyme| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0042597|"GO:periplasmic space"|Periplasm| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| COIL:NAA 36 COIL:NSEG 1 COIL:REGION 52->87| TM:NTM 1 TM:REGION 3->25| RP:PFM:NREP 1 RP:PFM:REP 6->142|PF03245|2e-32|63.5|137/153|Phage_lysis| HM:PFM:NREP 1 HM:PFM:REP 1->144|PF03245|2e-59|52.1|144/153|Phage_lysis| GO:PFM:NREP 1 GO:PFM GO:0019835|"GO:cytolysis"|PF03245|IPR004929| OP:NHOMO 185 OP:NHOMOORG 75 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---2-1BA22516111C-42146115B53432232-1---432-2112-132-3-3-13-13-11431-111---111-----2------------------------------------------------------------------------------1----------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------11-----11------1------------------------------------1---------------------------------------1-11---11--------111------------------ DISOP:02AL 1-1,91-106| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //