[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69271.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:41 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->34 PF11389 * Porin_OmpL1 0.0007 35.5 31/267  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69271.1 GT:GENE ACF69271.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1849151..1849276 GB:FROM 1849151 GB:TO 1849276 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF69271.1 GB:DB_XREF GI:194409052 LENGTH 41 SQ:AASEQ MMGTGSGANWINGVHSTCGAGKLTGSIDNLISPGRRCQRRF GT:EXON 1|1-41:0| HM:PFM:NREP 1 HM:PFM:REP 4->34|PF11389|0.0007|35.5|31/267|Porin_OmpL1| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,38-42| PSIPRED cccccccccHHHHHHHHccccEEcccHHHHcccHHHHHHcc //