[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69279.1
DDBJ      :             pyrazinamidase/nicotinamidase
Swiss-Prot:             

Homologs  Archaea  14/68 : Bacteria  358/915 : Eukaryota  117/199 : Viruses  0/175   --->[See Alignment]
c.33.1
:218 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->186 2h0rA PDBj 2e-25 35.5 %
:RPS:PDB   3->182 2a67A PDBj 3e-28 27.2 %
:RPS:SCOP  5->182 1nf8A  c.33.1.3 * 2e-32 18.8 %
:HMM:SCOP  1->208 1nbaA_ c.33.1.3 * 2.1e-50 38.9 %
:RPS:PFM   5->176 PF00857 * Isochorismatase 9e-32 52.8 %
:HMM:PFM   5->207 PF00857 * Isochorismatase 5.6e-39 33.5 173/174  
:BLT:SWISS 1->213 PNCA_ECOLI 5e-96 75.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69279.1 GT:GENE ACF69279.1 GT:PRODUCT pyrazinamidase/nicotinamidase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1376160..1376816) GB:FROM 1376160 GB:TO 1376816 GB:DIRECTION - GB:PRODUCT pyrazinamidase/nicotinamidase GB:NOTE identified by match to protein family HMM PF00857 GB:PROTEIN_ID ACF69279.1 GB:DB_XREF GI:194409060 LENGTH 218 SQ:AASEQ MTNRALLLVDLQNDFCAGGALAVAEGDSTIDIANALIDWCQPRQIPVLASQDWHPAQHGSFASQHQAEPYSQGELDGLPQTLWPDHCVQHTDGAALHPLLNQHAIDACIYKGENPLIDSYSAFFDNEHRQKTTLDTWLREHDVTELIVMGLATDYCVKFTVLDALELGYAVNVITDGCRGVNIHPQDSAHAFMEMAAAGATLYTLADWEETQGQAVAR GT:EXON 1|1-218:0| BL:SWS:NREP 1 BL:SWS:REP 1->213|PNCA_ECOLI|5e-96|75.6|213/213| SEG 189->200|ahafmemaaaga| BL:PDB:NREP 1 BL:PDB:REP 4->186|2h0rA|2e-25|35.5|183/216| RP:PDB:NREP 1 RP:PDB:REP 3->182|2a67A|3e-28|27.2|136/163| RP:PFM:NREP 1 RP:PFM:REP 5->176|PF00857|9e-32|52.8|144/173|Isochorismatase| HM:PFM:NREP 1 HM:PFM:REP 5->207|PF00857|5.6e-39|33.5|173/174|Isochorismatase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00857|IPR000868| GO:PFM GO:0008152|"GO:metabolic process"|PF00857|IPR000868| RP:SCP:NREP 1 RP:SCP:REP 5->182|1nf8A|2e-32|18.8|149/207|c.33.1.3| HM:SCP:REP 1->208|1nbaA_|2.1e-50|38.9|185/253|c.33.1.3|1/1|Isochorismatase-like hydrolases| OP:NHOMO 518 OP:NHOMOORG 489 OP:PATTERN ---1-------1-1-1-------1------------------------------1111111--11--- 1---11-111111111111-11--1111111111111111111111-1111-111111111111-121131----111-1---1-111------11---11--1----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-1----------1----------------------1--------1111111-212--------11111111111-1111111111--11111111111111---1111111111111111111111--11------------------------------------111-1111111111111-111111111-1111--111--------111-------1-1111111--1-----1------------111-1111-1111-1-----------------------------11-----1--1----------------------1111------11111111111111111-111111111111111111111211111111111111111111111111111--111111111111-----111111111--1----------------1111111---1-11-11-1-1---1-111--------------1111111---11--------1111--11-------111--1--------1---1--------2--------11-111111-2- 1---111-2121--111111111111111111111111-1111--1111111-1111-111111111111111111111111111111-12-112111112--111--113------------------------------------------------1122121-1112131-1-11712-1-----1----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 185 STR:RPRED 84.9 SQ:SECSTR ##cEEEEEEcccTTcccccccccTTHHHHHHHHHHHHHHHHHTTccEEEEEEccTTTcTTHHHHHHHccTTETcccEEEEEEHHcTccTTcTTTcccTTccccTTcEEEEEcccTTcccccTTTTccHHccccHHHHHHHTTccEEEEEEEcTTTHHHHHHHHHHHHTcEEEcTTcEEccccHHHHH############################### DISOP:02AL 1-1,216-219| PSIPRED ccccEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccHHHccccccEEEEcccccccccccccccccccccccHHHHHHHccccEEEEEEEcHHHHHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHHHcccEEEEHHHHHHHHHHHHcc //