[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69282.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:52 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->47 PF02118 * Srg 5.2e-05 17.8 45/275  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69282.1 GT:GENE ACF69282.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(947541..947699) GB:FROM 947541 GB:TO 947699 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF69282.1 GB:DB_XREF GI:194409063 LENGTH 52 SQ:AASEQ MQNITSLFTFYYCAITSSFFVIFFLIFYIKMRIITHQTANSSNQLIFNQNKY GT:EXON 1|1-52:0| TM:NTM 1 TM:REGION 9->30| HM:PFM:NREP 1 HM:PFM:REP 3->47|PF02118|5.2e-05|17.8|45/275|Srg| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11-1111----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,50-53| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEccccccEEEEccccc //