[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69303.1
DDBJ      :             packaged DNA stabilization protein gp4
Swiss-Prot:VG04_BPP22   RecName: Full=Packaged DNA stabilization protein gp4;

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  5/175   --->[See Alignment]
:166 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->160 PF11650 * P22_Tail-4 1e-48 66.4 %
:HMM:PFM   1->165 PF11650 * P22_Tail-4 7.6e-72 54.5 154/160  
:BLT:SWISS 1->166 VG04_BPP22 2e-95 99.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69303.1 GT:GENE ACF69303.1 GT:PRODUCT packaged DNA stabilization protein gp4 GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 402562..403062 GB:FROM 402562 GB:TO 403062 GB:DIRECTION + GB:PRODUCT packaged DNA stabilization protein gp4 GB:PROTEIN_ID ACF69303.1 GB:DB_XREF GI:194409084 LENGTH 166 SQ:AASEQ MQIKTKGDLVRAALRKLGVASDATLTDVEPQSMQDAVDDLEAMMAEWYQDGKGIITGYVFSDDDNPPAEGDDHGLRSSAVSAVFHNLACRIAPDYALEATAKIIATAKYGKELLYKQTAISRAKRAPYPSRMPTGSGNSFANLNEWHYFPGEQNADSTTPHDEGNG GT:EXON 1|1-166:0| SW:ID VG04_BPP22 SW:DE RecName: Full=Packaged DNA stabilization protein gp4; SW:GN Name=4; SW:KW Direct protein sequencing; Late protein. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->166|VG04_BPP22|2e-95|99.4|166/166| RP:PFM:NREP 1 RP:PFM:REP 1->160|PF11650|1e-48|66.4|152/156|P22_Tail-4| HM:PFM:NREP 1 HM:PFM:REP 1->165|PF11650|7.6e-72|54.5|154/160|P22_Tail-4| OP:NHOMO 21 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-11---------1-1------1---------1-11---1------1----111-----------------1------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------1------------1-----11------------------------------------1----------------------------------------------------------------------------- DISOP:02AL 1-4,66-76,155-167| PSIPRED ccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccc //