[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69304.1
DDBJ      :             cupin family protein
Swiss-Prot:YCFD_ECOLI   RecName: Full=Uncharacterized protein ycfD;

Homologs  Archaea  0/68 : Bacteria  243/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
b.82.2
:373 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->212 1vrbD PDBj 2e-07 29.7 %
:RPS:PDB   10->259 3d8cA PDBj 2e-20 13.0 %
:RPS:SCOP  7->205 1vrbA1  b.82.2.11 * 1e-49 23.2 %
:HMM:SCOP  7->293 1vrbA1 b.82.2.11 * 7.6e-77 33.0 %
:RPS:PFM   95->254 PF08007 * Cupin_4 1e-39 56.4 %
:HMM:PFM   10->310 PF08007 * Cupin_4 3.9e-106 39.9 301/319  
:BLT:SWISS 1->373 YCFD_ECOLI 0.0 93.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69304.1 GT:GENE ACF69304.1 GT:PRODUCT cupin family protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1320364..1321485) GB:FROM 1320364 GB:TO 1321485 GB:DIRECTION - GB:PRODUCT cupin family protein GB:NOTE identified by match to protein family HMM PF08007 GB:PROTEIN_ID ACF69304.1 GB:DB_XREF GI:194409085 LENGTH 373 SQ:AASEQ MEYQLTLNWPDFLEHHWQKRPVVLKRGFSNFIDPLSPDELAGLAMESEIDSRLVSHQDGKWQVSHGPFESYDHLGESNWSLLVQAVNHWHEPTAALMRPFRALPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLQMRQHCPHPDLLQVEPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNSRELISGFADYVLQRELGNTYYSDPDMPSRKHPADILPQEMDKLRNMMLDLINQPAHFQQWLGEFLSQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDEVYANGEKIDSPHRPALEALASHIALTAENFGDALEDPSFLAMLAALVNSGYWFFEG GT:EXON 1|1-373:0| SW:ID YCFD_ECOLI SW:DE RecName: Full=Uncharacterized protein ycfD; SW:GN Name=ycfD; OrderedLocusNames=b1128, JW1114; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->373|YCFD_ECOLI|0.0|93.6|373/373| SEG 300->313|gevlvrlgglrvlr| BL:PDB:NREP 1 BL:PDB:REP 11->212|1vrbD|2e-07|29.7|192/308| RP:PDB:NREP 1 RP:PDB:REP 10->259|3d8cA|2e-20|13.0|246/341| RP:PFM:NREP 1 RP:PFM:REP 95->254|PF08007|1e-39|56.4|156/185|Cupin_4| HM:PFM:NREP 1 HM:PFM:REP 10->310|PF08007|3.9e-106|39.9|301/319|Cupin_4| RP:SCP:NREP 1 RP:SCP:REP 7->205|1vrbA1|1e-49|23.2|190/302|b.82.2.11| HM:SCP:REP 7->293|1vrbA1|7.6e-77|33.0|282/0|b.82.2.11|1/1|Clavaminate synthase-like| OP:NHOMO 288 OP:NHOMOORG 255 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------1-------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111-11111111111111111111111111111111111111-121111---------1-1------------------------------------------------------------111111111111222211111121122212------1------12221211111111111-1111111111111111111222221111111111111111111211111111-222122221222--41-----1111-1111111-11111111--111111111111111111111111111111---------11111-------1--11111111111111----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------1--1-----------------------------------------------------1------------1-111-11------11----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 299 STR:RPRED 80.2 SQ:SECSTR ccGGEcTTcHHHHHHHcccccEEEEEEcccccccccGGGTTccccEEEEEEcHHHHHHHHHHHHHHTcEEEEEEEccTTccHHHHHHHHTccHHHHHHHHHHTTcccEEEcEEEEEcTTcEEEEEcccEEEEEEEEEccEEEGGHHHHccccTTcTTcTcccccTTcccTTTEcTTcEEEEcTTcEEEEEEcTcccEEEEEEEEEccccHHHHcccccccccHHHHHHHHHHHHHHHHHHTTcGGGHHHHHHHHHTTTTHHTTcTTcccccEEEcTTccccccccccTTTTGGGcccEE########################################################################## DISOP:02AL 1-2| PSIPRED ccccccccHHHHHHHHHHHccEEEEcccccccccccHHHHHHHHHHccccEEEEEEEcccEEEEEccccccccccHHHEEEEEccHHHHHHHHHHHHHHcccccccccccEEEEEEccccccccccccccEEEEEEEEEEEEEEcccccccHHcccccccccccccEEEEEEEccccEEEEcccccEEEEEcccEEEEEEEEccccHHHHHHHHHHHHHHccccccccccccccccccHHHccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccEEccccccccHHHHHHHHHccccEEEcccEEEEEEccEEEEEEEEcccccHHHHHHHHccccccHHHHHHHHccHHHHHHHHHHHHcccEEEcc //