[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69320.1
DDBJ      :             replication initiator protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:38 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69320.1 GT:GENE ACF69320.1 GT:PRODUCT replication initiator protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1525032..1525148 GB:FROM 1525032 GB:TO 1525148 GB:DIRECTION + GB:PRODUCT replication initiator protein GB:PROTEIN_ID ACF69320.1 GB:DB_XREF GI:194409101 LENGTH 38 SQ:AASEQ MGSCAAPSAKGDDKFITTDYLQQCPKCYKLSDIVKLLH GT:EXON 1|1-38:0| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10| PSIPRED ccccccccccccccccHHHHHHHcHHHHHHHHHHHHHc //