[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69325.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:YEBO_SALTY   RecName: Full=Uncharacterized protein yebO;

Homologs  Archaea  0/68 : Bacteria  58/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:95 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->80 PF03748 * FliL 8.1e-05 20.5 39/149  
:BLT:SWISS 1->95 YEBO_SALTY 2e-34 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69325.1 GT:GENE ACF69325.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1984369..1984656) GB:FROM 1984369 GB:TO 1984656 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF69325.1 GB:DB_XREF GI:194409106 LENGTH 95 SQ:AASEQ MNDVLNSGAFSLASLIVSMVVLVVGLALWFFVNRASSRANEQIELLEALLDQQKRQNALLRRLCEANEPEKEAEPATAASEPKEDEDIIRLVAER GT:EXON 1|1-95:0| SW:ID YEBO_SALTY SW:DE RecName: Full=Uncharacterized protein yebO; SW:GN Name=yebO; OrderedLocusNames=STM1839; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->95|YEBO_SALTY|2e-34|100.0|95/95| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 1 TM:REGION 10->32| SEG 65->84|eanepekeaepataasepke| HM:PFM:NREP 1 HM:PFM:REP 13->80|PF03748|8.1e-05|20.5|39/149|FliL| OP:NHOMO 58 OP:NHOMOORG 58 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1-1111111111-1111111111111111111111-----1111111111111111-1111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,4-5,66-85| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccHHcccccccHHHHHHHHHcc //