[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69347.1
DDBJ      :             putative phosphomannomutase
Swiss-Prot:RFBK_SALTY   RecName: Full=Phosphomannomutase;         Short=PMM;         EC=5.4.2.8;

Homologs  Archaea  53/68 : Bacteria  513/915 : Eukaryota  13/199 : Viruses  0/175   --->[See Alignment]
c.84.1d.129.2
:477 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->473 1wqaA PDBj 2e-22 26.2 %
:RPS:PDB   16->473 3bkqX PDBj 3e-56 16.9 %
:RPS:SCOP  14->172 1c47A1  c.84.1.1 * 3e-20 22.6 %
:RPS:SCOP  162->261 1k2yX2  c.84.1.1 * 3e-14 20.4 %
:RPS:SCOP  263->375 1k2yX3  c.84.1.1 * 2e-09 14.0 %
:RPS:SCOP  418->473 1k2yX4  d.129.2.1 * 7e-08 21.8 %
:HMM:SCOP  13->188 1kfiA1 c.84.1.1 * 1.2e-28 28.9 %
:HMM:SCOP  159->261 3pmgA2 c.84.1.1 * 1.2e-14 30.4 %
:HMM:SCOP  246->386 1kfiA3 c.84.1.1 * 3e-06 29.7 %
:HMM:SCOP  380->475 1wjwA_ d.129.2.1 * 1.1e-08 24.2 %
:RPS:PFM   18->127 PF02878 * PGM_PMM_I 5e-16 41.8 %
:RPS:PFM   412->465 PF00408 * PGM_PMM_IV 6e-06 42.3 %
:HMM:PFM   16->138 PF02878 * PGM_PMM_I 2.1e-34 38.2 123/138  
:HMM:PFM   262->379 PF02880 * PGM_PMM_III 5.5e-13 29.8 104/111  
:HMM:PFM   161->258 PF02879 * PGM_PMM_II 7.8e-11 26.8 97/105  
:HMM:PFM   422->471 PF00408 * PGM_PMM_IV 1e-10 32.0 50/73  
:BLT:SWISS 1->477 RFBK_SALTY 0.0 100.0 %
:PROS 105->114|PS00710|PGM_PMM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69347.1 GT:GENE ACF69347.1 GT:PRODUCT putative phosphomannomutase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2210052..2211485) GB:FROM 2210052 GB:TO 2211485 GB:DIRECTION - GB:PRODUCT putative phosphomannomutase GB:NOTE identified by match to protein family HMM PF00408; match to protein family HMM PF02878; match to protein family HMM PF02879; match to protein family HMM PF02880 GB:PROTEIN_ID ACF69347.1 GB:DB_XREF GI:194409128 LENGTH 477 SQ:AASEQ MNVVNNSRDVIYSSGIVFGTSGARGLVKDFTPQVCAAFTVSFVAVMQEHFSFDTVALAIDNRPSSYGMAQACAAALADKGVNCIFYGVVPTPALAFQSMSDNMPAIMVTGSHIPFERNGLKFYRPDGEITKHDEAAILSVEDTCSHLELKELIVSEMAAVNYISRYTSLFSTPFLKNKRIGIYEHSSAGRDLYKPLFIALGAEVVSLGRSDNFVPIDTEAVSKEDREKARSWAKEFDLDAIFSTDGDGDRPLIADEAGEWLRGDILGLLCSLALDAEAVAIPVSCNSIISSGRFFKHVKLTKIGSPYVIEAFNELSRSYSRIVGFEANGGFLLGSDICINEQNLHALPTRDAVLPAIMLLYKSRNTSISALVNELPTRYTHSDRLQGITTDKSQSLISMGRENLSNLLSYIGLENEGAISTDMTDGMRITLRDGCIVHLRASGNAPELRCYAEANLLNRAQDLVNTTLANIKKRCLL GT:EXON 1|1-477:0| SW:ID RFBK_SALTY SW:DE RecName: Full=Phosphomannomutase; Short=PMM; EC=5.4.2.8; SW:GN Name=rfbK; OrderedLocusNames=STM2083; SW:KW Cell membrane; Complete proteome; Isomerase;Lipopolysaccharide biosynthesis; Magnesium; Membrane; Metal-binding;Phosphoprotein; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->477|RFBK_SALTY|0.0|100.0|477/477| GO:SWS:NREP 6 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| GO:SWS GO:0009103|"GO:lipopolysaccharide biosynthetic process"|Lipopolysaccharide biosynthesis| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| PROS 105->114|PS00710|PGM_PMM|PDOC00589| BL:PDB:NREP 1 BL:PDB:REP 15->473|1wqaA|2e-22|26.2|432/455| RP:PDB:NREP 1 RP:PDB:REP 16->473|3bkqX|3e-56|16.9|431/457| RP:PFM:NREP 2 RP:PFM:REP 18->127|PF02878|5e-16|41.8|110/137|PGM_PMM_I| RP:PFM:REP 412->465|PF00408|6e-06|42.3|52/76|PGM_PMM_IV| HM:PFM:NREP 4 HM:PFM:REP 16->138|PF02878|2.1e-34|38.2|123/138|PGM_PMM_I| HM:PFM:REP 262->379|PF02880|5.5e-13|29.8|104/111|PGM_PMM_III| HM:PFM:REP 161->258|PF02879|7.8e-11|26.8|97/105|PGM_PMM_II| HM:PFM:REP 422->471|PF00408|1e-10|32.0|50/73|PGM_PMM_IV| GO:PFM:NREP 4 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF02878|IPR005844| GO:PFM GO:0016868|"GO:intramolecular transferase activity, phosphotransferases"|PF02878|IPR005844| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF00408|IPR005843| GO:PFM GO:0016868|"GO:intramolecular transferase activity, phosphotransferases"|PF00408|IPR005843| RP:SCP:NREP 4 RP:SCP:REP 14->172|1c47A1|3e-20|22.6|159/190|c.84.1.1| RP:SCP:REP 162->261|1k2yX2|3e-14|20.4|98/104|c.84.1.1| RP:SCP:REP 263->375|1k2yX3|2e-09|14.0|100/109|c.84.1.1| RP:SCP:REP 418->473|1k2yX4|7e-08|21.8|55/96|d.129.2.1| HM:SCP:REP 13->188|1kfiA1|1.2e-28|28.9|173/203|c.84.1.1|1/1|Phosphoglucomutase, first 3 domains| HM:SCP:REP 159->261|3pmgA2|1.2e-14|30.4|102/113|c.84.1.1|1/1|Phosphoglucomutase, first 3 domains| HM:SCP:REP 246->386|1kfiA3|3e-06|29.7|111/120|c.84.1.1|1/1|Phosphoglucomutase, first 3 domains| HM:SCP:REP 380->475|1wjwA_|1.1e-08|24.2|95/0|d.129.2.1|1/1|Phosphoglucomutase, C-terminal domain| OP:NHOMO 696 OP:NHOMOORG 579 OP:PATTERN --2121--1111111---1111112--11-11212--11111111111-133121212222111--11 --1--1--111-------------1------1------1--------1-------1--11-----1------------111---1------------------1------111111111111111-----1---11-----111-1111-11----------11---1-111---111-1--1111-1-1--11111111111111111111122111111111111121121---------------111111-1-12-21--2211111-111--11222211121111111111111221222222222111111-1111111131111111111--111222111---11-111111-121-11111---1111111111111-----------33333332332-------121311222222222211--1-1122221121111111111-2211111-----------------------------1-211------111111111111111111111111-1-11-1111-1111111-11--1131111111111-11-112-1-11--11211--1111-111111211111111111111111111111111-11111111-111-1111-1---1--1-------1-1--11---1--------1-1-----------------------1---------1-11-1-11111111-1111-1-------1-11111111111111-211111----1-2--1111111121-11111111111--1--1111-11----------1222222221----2222221--1--1-1---------111-----------------2-----------------1-------22-22111111-- ----1---------------1111-1-----------------------------------------------------------------------------------------------------------------------------------------2---------------------1111-31------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 463 STR:RPRED 97.1 SQ:SECSTR ##########cccTTGGcccccEEEEcTTccHHHHHHHHHHHHHHHcHHTTccEEEEEEcccTTHHHHHHHHHHHHHTcTcEEEEEEEccHHHHHHHHHHccccEEEEEccTccTTEEEEEEEETTEEccTHHHHHHHHHHHHTcccccccEEEEcccHHHHHHHHHHHccHccccccEEEEEcTTcGGGGTHHHHHHHTTcEEEEEcccTTcccccccTTcGGGcHHHHHHHHHTTccEEEEEcTTcccEEEEETTccEEcHHHHHHHHHHHHHHHEEEEETTccTHHHHHHTTcEEEEEcccHHHHHHHHHHccEEHcccEEEcTTccEEEcTcHHHHHHHHTccccccHHHHHHHHHHHHccccHHHHHHTTcccEEcccEEEEccTTTHHHHHHHHHHHcccTTTTTTEEcccccEEEccccEEEEETTEEEEEEEEcccccEEEEEEEEccHHHHHHHHHHHHHHHHH#### DISOP:02AL 1-4| PSIPRED ccccHHHHHHHHccccEEccccccEEcccccHHHHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHccccEEEEEEcccccccccEEEEccccccccHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHHccccEEEEccccccccccccccccccHHHHHHHHHHccccEEEEEcccccEEEEEcccccEEcHHHHHHHHHHHHHHccccccEEEHHHHHHHHccccEEEcccccHHHHHHHHHHHHcccEEEEEEccccEEEcccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEcccEEEEEEccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHcc //