[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69360.1
DDBJ      :             bifunctional adenosylcobalamin biosynthesis protein CobU
Swiss-Prot:COBU_SALTY   RecName: Full=Bifunctional adenosylcobalamin biosynthesis protein cobU;Includes:  RecName: Full=Adenosylcobinamide kinase;           EC=2.7.1.156;Includes:  RecName: Full=Adenosylcobinamide-phosphate guanylyltransferase;           EC=2.7.7.62;

Homologs  Archaea  1/68 : Bacteria  440/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:181 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->181 1c9kB PDBj e-102 98.3 %
:RPS:PDB   2->181 1cbuC PDBj 1e-06 87.7 %
:RPS:SCOP  2->181 1c9kA  c.37.1.11 * 2e-59 97.6 %
:HMM:SCOP  2->181 1cbuA_ c.37.1.11 * 9.3e-55 41.7 %
:RPS:PFM   4->180 PF02283 * CobU 4e-42 57.0 %
:HMM:PFM   3->180 PF02283 * CobU 2.2e-62 48.2 166/167  
:BLT:SWISS 1->181 COBU_SALTY e-102 98.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69360.1 GT:GENE ACF69360.1 GT:PRODUCT bifunctional adenosylcobalamin biosynthesis protein CobU GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2146755..2147300) GB:FROM 2146755 GB:TO 2147300 GB:DIRECTION - GB:PRODUCT bifunctional adenosylcobalamin biosynthesis protein CobU GB:NOTE identified by match to protein family HMM PF02283 GB:PROTEIN_ID ACF69360.1 GB:DB_XREF GI:194409141 LENGTH 181 SQ:AASEQ MMILVTGGARSGKSRHAETLIGDAPQVLYIATSQILDDEMAARIQHHKDGRPAHWRTAECWRHLDTLITADLAPDDAILLECITTMVTNLLFALGGENDPEQWDYAAMERGIDDEIQILIAACQRCPAKVVLVTNEVGMGIVPENRLARHFRDIAGRVNQRLSAAADEVWLVVSGIGVKIK GT:EXON 1|1-181:0| SW:ID COBU_SALTY SW:DE RecName: Full=Bifunctional adenosylcobalamin biosynthesis protein cobU;Includes: RecName: Full=Adenosylcobinamide kinase; EC=2.7.1.156;Includes: RecName: Full=Adenosylcobinamide-phosphate guanylyltransferase; EC=2.7.7.62; SW:GN Name=cobU; OrderedLocusNames=STM2018; SW:KW 3D-structure; ATP-binding; Cobalamin biosynthesis; Complete proteome;GTP-binding; Kinase; Multifunctional enzyme; Nucleotide-binding;Transferase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->181|COBU_SALTY|e-102|98.3|181/181| GO:SWS:NREP 7 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0009236|"GO:cobalamin biosynthetic process"|Cobalamin biosynthesis| GO:SWS GO:0005525|"GO:GTP binding"|GTP-binding| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0003824|"GO:catalytic activity"|Multifunctional enzyme| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 2->181|1c9kB|e-102|98.3|180/180| RP:PDB:NREP 1 RP:PDB:REP 2->181|1cbuC|1e-06|87.7|179/179| RP:PFM:NREP 1 RP:PFM:REP 4->180|PF02283|4e-42|57.0|165/167|CobU| HM:PFM:NREP 1 HM:PFM:REP 3->180|PF02283|2.2e-62|48.2|166/167|CobU| GO:PFM:NREP 4 GO:PFM GO:0000166|"GO:nucleotide binding"|PF02283|IPR003203| GO:PFM GO:0043752|"GO:adenosylcobinamide kinase activity"|PF02283|IPR003203| GO:PFM GO:0043753|"GO:adenosylcobinamide-phosphate guanylyltransferase activity"|PF02283|IPR003203| GO:PFM GO:0051188|"GO:cofactor biosynthetic process"|PF02283|IPR003203| RP:SCP:NREP 1 RP:SCP:REP 2->181|1c9kA|2e-59|97.6|170/170|c.37.1.11| HM:SCP:REP 2->181|1cbuA_|9.3e-55|41.7|180/0|c.37.1.11|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 448 OP:NHOMOORG 441 OP:PATTERN -----------------------------------------1-------------------------- ----1-11111-1-1-111-11--111111111---12111111----------------11111111111----------11-----11-1-111-----11--1-1-----------------1111111111111111112--1111111111111111-1111111111111111111-11111----1-----------------1-------111----11111121---------------------------------11---------------------------------------------1----------111-1111111-1-11111----11--11-1111111--111111--1111-1--------1-111---1111111111111111-21111111-1--1111111111111111-1-1111111111111111-11-1111-------------------------------1--------11111--111111111111111-11111--111111111111--111111111----------111-1111--1---111-111111111-----1-1-----------------------------1-111-11-11111--111111111131----11-------1---1--1111111111--11111111111111111-111--11-1111111111111111--211-11--1------------------------111-1---------------111111----11111111111----1111-------------11111111111--11111111------1---1111--------1---------------------------11-11-1-----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 180 STR:RPRED 99.4 SQ:SECSTR #cEEEEEcTTccHHHHHHHHHccccEEEEEEccHHHHHHHHHHTTTccccccEEEEEEccccGGGTTccccccTTcEEEEEcHHHHHHHHHHHHcTTccGGGccHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHccEEEEEETTEEEEcc PSIPRED cEEEEEccccccHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHcccccEEEEEcHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHccEEEEEEEcEEEEcc //