[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69462.1
DDBJ      :             nucleoside diphosphate kinase regulator
Swiss-Prot:RNK_SHIFL    RecName: Full=Regulator of nucleoside diphosphate kinase;

Homologs  Archaea  0/68 : Bacteria  250/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.26.1
:136 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->135 3bmbA PDBj 1e-68 91.8 %
:RPS:PDB   2->134 3bmbA PDBj 4e-38 91.7 %
:RPS:SCOP  51->125 2etnA2  d.26.1.2 * 1e-18 29.7 %
:HMM:SCOP  48->127 1grjA2 d.26.1.2 * 1.3e-19 45.6 %
:RPS:PFM   52->125 PF01272 * GreA_GreB 1e-08 39.7 %
:HMM:PFM   50->126 PF01272 * GreA_GreB 1.4e-21 35.5 76/77  
:HMM:PFM   11->63 PF04843 * Herpes_teg_N 0.00041 21.6 51/172  
:BLT:SWISS 1->135 RNK_SHIFL 1e-68 91.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69462.1 GT:GENE ACF69462.1 GT:PRODUCT nucleoside diphosphate kinase regulator GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(727773..728183) GB:FROM 727773 GB:TO 728183 GB:DIRECTION - GB:PRODUCT nucleoside diphosphate kinase regulator GB:NOTE identified by match to protein family HMM PF01272 GB:PROTEIN_ID ACF69462.1 GB:DB_XREF GI:194409243 LENGTH 136 SQ:AASEQ MSRPTIIINDLDAERIDRLLEQPAYADLPIADALNAELDRAQMCSPQEMPNDVVTMNSRVKFRNLSDGETRVRTLVYPANMTDSSTQLSVMAPVGAALLGLRVGDTIHWELPGGASTHLEVLELEYQPEAAGDFLR GT:EXON 1|1-136:0| SW:ID RNK_SHIFL SW:DE RecName: Full=Regulator of nucleoside diphosphate kinase; SW:GN Name=rnk; OrderedLocusNames=SF0528, S0534; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->135|RNK_SHIFL|1e-68|91.9|135/136| BL:PDB:NREP 1 BL:PDB:REP 2->135|3bmbA|1e-68|91.8|134/135| RP:PDB:NREP 1 RP:PDB:REP 2->134|3bmbA|4e-38|91.7|133/135| RP:PFM:NREP 1 RP:PFM:REP 52->125|PF01272|1e-08|39.7|73/78|GreA_GreB| HM:PFM:NREP 2 HM:PFM:REP 50->126|PF01272|1.4e-21|35.5|76/77|GreA_GreB| HM:PFM:REP 11->63|PF04843|0.00041|21.6|51/172|Herpes_teg_N| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF01272|IPR001437| GO:PFM GO:0003711|"GO:transcription elongation regulator activity"|PF01272|IPR001437| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01272|IPR001437| RP:SCP:NREP 1 RP:SCP:REP 51->125|2etnA2|1e-18|29.7|74/79|d.26.1.2| HM:SCP:REP 48->127|1grjA2|1.3e-19|45.6|79/79|d.26.1.2|1/1|FKBP-like| OP:NHOMO 264 OP:NHOMOORG 251 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------1-1--1111-2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111----------------1--2----------1111-11-111-1-11111-32-1121-111------------1---1-2--1111------------------1-------------------------------12---11--111111-1111111-1111-11111111--111-121111--1----111111-------11111-1-1---11-------1-1112--1--2-1111---------------------------11--1--111-11111-1-1111-1--1-----1111------1111-1-1111111111-1121111111111111111111111111111111111111111111-1111--111111111111---1----------1--1--------------------------111111211111111111--------------11111-1-111111111111--------11----------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 134 STR:RPRED 98.5 SQ:SECSTR #cccccEEEHHHHHHHHHHHHcGGGTTcHHHHHHHHHHHTcEEEcGGGccTTcccTTcEEEEEETTTccEEEEEEEcGGGcccTTTEEETTcHHHHHHTTccTTcEEEEEETTTEEEEEEEEEEEEcTTTTTccc# DISOP:02AL 1-2,130-137| PSIPRED cccccEEEEHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcEEEcHHHccccccccccEEEEEEcccccEEEEEEccHHHcccccccEEEccHHHHHHcccccccEEEEEcccccEEEEEEEEEEEcccccccccc //