[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69471.1
DDBJ      :             putative outer membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:175 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   49->164 3d9rB PDBj 3e-12 15.5 %
:RPS:SCOP  31->165 1hkxA  d.17.4.7 * 1e-18 22.7 %
:HMM:SCOP  28->169 1hkxA_ d.17.4.7 * 7.9e-17 23.5 %
:RPS:PFM   110->165 PF08332 * CaMKII_AD 8e-05 36.4 %
:HMM:PFM   39->165 PF08332 * CaMKII_AD 2.5e-09 22.1 122/128  
:HMM:PFM   5->52 PF02382 * RTX 0.00046 33.3 48/653  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69471.1 GT:GENE ACF69471.1 GT:PRODUCT putative outer membrane protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1652294..1652821) GB:FROM 1652294 GB:TO 1652821 GB:DIRECTION - GB:PRODUCT putative outer membrane protein GB:PROTEIN_ID ACF69471.1 GB:DB_XREF GI:194409252 LENGTH 175 SQ:AASEQ MQKTSLLFSAAAITLTLMASSASAATPTAAQNEATSTVKQEITEGINRYLYSIDKADPTLGKQLFYVSPETSFIHPRGHERGWSQIAENFYGATMGKTFSKRTLKLDAPPAIHVYGNAAVAEFDWHFTAVRRDNGQTQHTTGRESQVWAKIPNTGWRIVHVHYSGPAKTGVGEGY GT:EXON 1|1-175:0| SEG 9->30|saaaitltlmassasaatptaa| RP:PDB:NREP 1 RP:PDB:REP 49->164|3d9rB|3e-12|15.5|110/131| RP:PFM:NREP 1 RP:PFM:REP 110->165|PF08332|8e-05|36.4|55/127|CaMKII_AD| HM:PFM:NREP 2 HM:PFM:REP 39->165|PF08332|2.5e-09|22.1|122/128|CaMKII_AD| HM:PFM:REP 5->52|PF02382|0.00046|33.3|48/653|RTX| GO:PFM:NREP 3 GO:PFM GO:0004683|"GO:calmodulin-dependent protein kinase activity"|PF08332|IPR013543| GO:PFM GO:0005516|"GO:calmodulin binding"|PF08332|IPR013543| GO:PFM GO:0006468|"GO:protein amino acid phosphorylation"|PF08332|IPR013543| RP:SCP:NREP 1 RP:SCP:REP 31->165|1hkxA|1e-18|22.7|128/140|d.17.4.7| HM:SCP:REP 28->169|1hkxA_|7.9e-17|23.5|136/0|d.17.4.7|1/1|NTF2-like| OP:NHOMO 17 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------1-11111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 140 STR:RPRED 80.0 SQ:SECSTR ##############################cccHHHHHHHHHHHHHHHHHHHHHTTcHHHHHHTEEEEEEEEEcTTcccEEcHHHHHHHHHHHHHHEEEEEEEEEEEEEEEEEEETTEEEEEEEEEEEEEETTTccEEEEEEEEEEEEEEcTTccEEEEEEEEEEccGGG##### DISOP:02AL 1-4,24-36,137-140,171-176| PSIPRED ccccEEEEEEEEEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHEEcccccccccEEEEEcccccEEcccccccHHHHHHHHHHHHHHcccccccEEEEccccEEEEEcccEEEEEEEEEEEEEEcccccccccccccEEEEEcccccEEEEEEEEcccccccccccc //