[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69475.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:YDHZ_SALTY   RecName: Full=Uncharacterized protein ydhZ;

Homologs  Archaea  0/68 : Bacteria  56/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:70 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->69 PF10965 * DUF2767 4e-24 87.0 %
:HMM:PFM   1->68 PF10965 * DUF2767 1.5e-41 80.9 68/69  
:BLT:SWISS 1->70 YDHZ_SALTY 5e-35 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69475.1 GT:GENE ACF69475.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1479335..1479547 GB:FROM 1479335 GB:TO 1479547 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF69475.1 GB:DB_XREF GI:194409256 LENGTH 70 SQ:AASEQ MTKPTKDDELYREMCRVVGKVVLEMRDLGQEPKYIVIAGVLRTALANQRIQRSALEKQAMETVINALARS GT:EXON 1|1-70:0| SW:ID YDHZ_SALTY SW:DE RecName: Full=Uncharacterized protein ydhZ; SW:GN Name=ydhZ; OrderedLocusNames=STM1388; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->70|YDHZ_SALTY|5e-35|100.0|70/70| RP:PFM:NREP 1 RP:PFM:REP 1->69|PF10965|4e-24|87.0|69/69|DUF2767| HM:PFM:NREP 1 HM:PFM:REP 1->68|PF10965|1.5e-41|80.9|68/69|DUF2767| OP:NHOMO 56 OP:NHOMOORG 56 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-1111111-11-1111111111111111111111-----1111111111111111-1111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,70-71| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //