Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69480.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:38 amino acids

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69480.1 GT:GENE ACF69480.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1942682..1942798) GB:FROM 1942682 GB:TO 1942798 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF69480.1 GB:DB_XREF GI:194409261 LENGTH 38 SQ:AASEQ MIEPLFCEQTDILLRQNLSARAWKTGYTDKKSTPGRGF GT:EXON 1|1-38:0| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 32-39| PSIPRED cccccccccHHHHHHccccHHHHHcccccccccccccc //