[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69487.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:39 amino acids
:PSIPRED
:HMM:PFM   5->37 PF10292 * 7TM_GPCR_Srab 0.00027 24.2 33/324  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69487.1 GT:GENE ACF69487.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2835310..2835429) GB:FROM 2835310 GB:TO 2835429 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF69487.1 GB:DB_XREF GI:194409268 LENGTH 39 SQ:AASEQ MSFNLIFFFFFNIKTIPFVKVFSNIKFYKNHLKYCVIRL GT:EXON 1|1-39:0| SEG 3->13|fnlifffffni| HM:PFM:NREP 1 HM:PFM:REP 5->37|PF10292|0.00027|24.2|33/324|7TM_GPCR_Srab| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccEEEEEEEEEccccccHHHHHHccHHHHHHHEEEEEEc //