[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69490.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:246 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   105->119 PF02260 * FATC 0.00076 53.3 15/33  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69490.1 GT:GENE ACF69490.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 831401..832141 GB:FROM 831401 GB:TO 832141 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF69490.1 GB:DB_XREF GI:194409271 LENGTH 246 SQ:AASEQ MQTLTRVLPPLRLIMFCQSGENPAQFPDTGGLCVEDCVRLRTPEGLLDRLRRWPGAMVISAGRPSTQLLLWQQVFQRYPRTVVFCSSNAFLPVDVSVEGYFRHLRLIKRAMSVRVLARMAELAIWSSLQTSPYEEEMKSALSVPELVMEINSRTLVRLLSERLPKQGRRVLGLLLSGCSPEMTARMLGTGVRQVWLAEQTLKQRWDIPTGVPLSDAVRIRIPDVGPDISQQSGLVKTGAGNAPDLC GT:EXON 1|1-246:0| HM:PFM:NREP 1 HM:PFM:REP 105->119|PF02260|0.00076|53.3|15/33|FATC| OP:NHOMO 20 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-111-1-1--1------11---------------1--1-1-11--1111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,241-241| PSIPRED ccHHHHHcccEEEEEEcccccccccccccccccHHHEEEcccHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHccEEEEEEccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccHHEEHHHHHccHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHHHHccccccccHHHEEEEEccccccccHHHcccEEcccccccccc //