[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69497.1
DDBJ      :             putative periplasmic protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:275 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   196->271 PF07007 * DUF1311 7e-04 32.4 %
:HMM:PFM   192->271 PF07007 * DUF1311 1.9e-11 25.6 78/95  
:BLT:SWISS 2->64 MYO1_CRYNE 2e-04 41.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69497.1 GT:GENE ACF69497.1 GT:PRODUCT putative periplasmic protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(604212..605039) GB:FROM 604212 GB:TO 605039 GB:DIRECTION - GB:PRODUCT putative periplasmic protein GB:PROTEIN_ID ACF69497.1 GB:DB_XREF GI:194409278 LENGTH 275 SQ:AASEQ MFRKAVTLLFLLSPAVSYAGLFDSTPELKCGNDNAVTAAKEWIYNEALGRLQQDYIKEPSTLFFDIPQTQYEQQLRAIPVQFSDVITQNPQAENANLRTCSATVAMGIPQPLFKLMKDLPNTLFYISQGDGQVINNTVTWKQVNYNIQLADNNKDIVVTSVQKTDKLARSIYVMARMTVSGDSIIKKKNNSLIEIAAKKFESRDRELNQVWNSLPASARTALKQEQRVWVTQKEQQCGKLSDAKSEAIPAEKRISIYKCQLEMTIARTAYLDSSE GT:EXON 1|1-275:0| BL:SWS:NREP 1 BL:SWS:REP 2->64|MYO1_CRYNE|2e-04|41.4|58/100| TM:NTM 1 TM:REGION 5->27| RP:PFM:NREP 1 RP:PFM:REP 196->271|PF07007|7e-04|32.4|74/93|DUF1311| HM:PFM:NREP 1 HM:PFM:REP 192->271|PF07007|1.9e-11|25.6|78/95|DUF1311| OP:NHOMO 16 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---1-1111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,236-247,272-276| PSIPRED ccHHHHHHHHHHcHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHcccccHHHHHHcccccccccEEEEEEEEEccccHHHHHHHHHccccEEEEEccccEEEEEEEEEEEEEEEEEEEcccccEEEEEHHHHHHHHHHEEEEEEEEEcccHHEEcccccEEEEHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHEEEEEHHHHHccccccccccccccccEEEEEEEEEEEEEEEEEEccccc //