[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69512.1
DDBJ      :             protease 7
Swiss-Prot:PGTE_SALTY   RecName: Full=Outer membrane protease E;         Short=E protein;         EC=3.4.23.-;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  65/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.4.4
:312 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->312 1i78A PDBj 3e-86 51.8 %
:RPS:SCOP  28->312 1i78A  f.4.4.1 * e-112 51.1 %
:HMM:SCOP  23->312 1i78A_ f.4.4.1 * 1.5e-116 50.2 %
:RPS:PFM   30->312 PF01278 * Omptin e-107 70.0 %
:HMM:PFM   26->312 PF01278 * Omptin 2.8e-149 64.8 287/295  
:HMM:PFM   5->37 PF10880 * DUF2673 0.0005 40.0 30/65  
:BLT:SWISS 1->312 PGTE_SALTY 0.0 99.7 %
:PROS 53->65|PS00018|EF_HAND_1
:PROS 115->124|PS00834|OMPTIN_1
:PROS 152->168|PS00835|OMPTIN_2

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69512.1 GT:GENE ACF69512.1 GT:PRODUCT protease 7 GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2563186..2564124) GB:FROM 2563186 GB:TO 2564124 GB:DIRECTION - GB:PRODUCT protease 7 GB:NOTE identified by match to protein family HMM PF01278 GB:PROTEIN_ID ACF69512.1 GB:DB_XREF GI:194409293 LENGTH 312 SQ:AASEQ MKKHAIAVMMIAVFSESVYAESALFIPDVSPDSVTTSLSVGVLNGKSRELVYDTDTGRKLSQLDWKIKNVATLQGDLSWEPYSFMTLDARGWTSLASGSGHMVDHDWMSSEQPGWTDRSIHPDTSANYANEYDLNVKGWLLQGDNYKAGVTAGYQETRFSWTARGGSYIYDNGRYIGNFPHGVRGIGYSQRFEMPYIGLAGDYRINDFECNVLFKYSDWVNAHDNDEHYMRKLTFREKTENSRYYGASIDAGYYITSNAKIFAEFAYSKYEEGKGGTQIIDKTSGDTAYFGGDAAGIANNNYTVTAGLQYRF GT:EXON 1|1-312:0| SW:ID PGTE_SALTY SW:DE RecName: Full=Outer membrane protease E; Short=E protein; EC=3.4.23.-;Flags: Precursor; SW:GN Name=pgtE; Synonyms=prtA; OrderedLocusNames=STM2395; SW:KW Aspartyl protease; Cell membrane; Cell outer membrane;Complete proteome; Hydrolase; Membrane; Protease; Signal;Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->312|PGTE_SALTY|0.0|99.7|312/312| GO:SWS:NREP 7 GO:SWS GO:0004190|"GO:aspartic-type endopeptidase activity"|Aspartyl protease| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0009279|"GO:cell outer membrane"|Cell outer membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| PROS 53->65|PS00018|EF_HAND_1|PDOC00018| PROS 115->124|PS00834|OMPTIN_1|PDOC00657| PROS 152->168|PS00835|OMPTIN_2|PDOC00657| BL:PDB:NREP 1 BL:PDB:REP 30->312|1i78A|3e-86|51.8|282/297| RP:PFM:NREP 1 RP:PFM:REP 30->312|PF01278|e-107|70.0|283/290|Omptin| HM:PFM:NREP 2 HM:PFM:REP 26->312|PF01278|2.8e-149|64.8|287/295|Omptin| HM:PFM:REP 5->37|PF10880|0.0005|40.0|30/65|DUF2673| GO:PFM:NREP 3 GO:PFM GO:0004175|"GO:endopeptidase activity"|PF01278|IPR000036| GO:PFM GO:0006508|"GO:proteolysis"|PF01278|IPR000036| GO:PFM GO:0009279|"GO:cell outer membrane"|PF01278|IPR000036| RP:SCP:NREP 1 RP:SCP:REP 28->312|1i78A|e-112|51.1|284/297|f.4.4.1| HM:SCP:REP 23->312|1i78A_|1.5e-116|50.2|289/0|f.4.4.1|1/1|OMPT-like| OP:NHOMO 76 OP:NHOMOORG 65 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------11---11-------1----------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------1---1-11111112---1-2111--1-131--11---1------1211111111111111-1111--1---21212231-11---------1111------------------------------------------------------------1------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 282 STR:RPRED 90.4 SQ:SECSTR #############################cTTcEEEEEEEEEEEEEEEEEEEETTTTEEEEEEEEEEEEEEEEEEEEEEcccccEEEEEEEEEEcccEEEEEEEEEcccTTcTTccEEEEEEEEEEEEEEEEEEEEEEEEEEcccEEEEEEEEEEEEEEEEEEEccEEEcccTTccccccTTccEEEEEEEEEEEEEEEEEEEEETTEEEEEEEEEEEEEEEEEEEEEEcccEEEEEEEEEEEEEEEEEEEEEEEETTEEEEEEEEEEEEEEEEEEEEEEET#TTTEEEEEEEEEEEEEEEEEEEEEEEEEc DISOP:02AL 1-3| PSIPRED ccccEEEEEEEEccccHHHcccHHcccccccccEEEEEEEEEEEEEEEEEEEEcccccEEEEEEEcccccEEEEEEEEEEEcccEEEEEEEEEEEEcccccEEccccccccccccccEEEcccccccEEEEEEEEccccEEEcccEEEEEEEEEEEEEEEEEEcccEEEccccccccccccccEEEEEEEEEEEEEEEEEEEEEEccEEEEEEEEEEEEEEEccccccEEEEEEEEEEEccccEEEEEEEEEEEEcccEEEEEEEEEEEEEEEcccEEEEEcccccEEEEccccccEEEEEEEEEEEEEEEc //