[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69516.1
DDBJ      :             inner membrane protein YfbW
Swiss-Prot:ARNE_SALSV   RecName: Full=Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit arnE;         Short=L-Ara4N-phosphoundecaprenol flippase subunit arnE;AltName: Full=Undecaprenyl phosphate-aminoarabinose flippase subunit arnE;

Homologs  Archaea  0/68 : Bacteria  56/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:111 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  4->107 1s7bA_ f.39.1.1 * 4.1e-12 34.4 %
:HMM:PFM   4->100 PF00893 * Multi_Drug_Res 1.8e-11 30.3 89/93  
:BLT:SWISS 19->94 ARNE_SALSV 7e-44 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69516.1 GT:GENE ACF69516.1 GT:PRODUCT inner membrane protein YfbW GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2458173..2458508 GB:FROM 2458173 GB:TO 2458508 GB:DIRECTION + GB:PRODUCT inner membrane protein YfbW GB:NOTE identified by match to protein family HMM PF00893 GB:PROTEIN_ID ACF69516.1 GB:DB_XREF GI:194409297 LENGTH 111 SQ:AASEQ MIGIVLVLASLLSVGGQLCQKQATRPLTTGGRRRHLMLWLGLALICMGAAMVLWLLVLQTLPVGIAYPMLSLNFVWVTLAAWKIWHEQVPPRHWLGVALIISGIIILGSAA GT:EXON 1|1-111:0| SW:ID ARNE_SALSV SW:DE RecName: Full=Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit arnE; Short=L-Ara4N-phosphoundecaprenol flippase subunit arnE;AltName: Full=Undecaprenyl phosphate-aminoarabinose flippase subunit arnE; SW:GN Name=arnE; OrderedLocusNames=SeSA_A2530; SW:KW Cell inner membrane; Cell membrane; Complete proteome;Lipid A biosynthesis; Lipid synthesis;Lipopolysaccharide biosynthesis; Membrane; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 19->94|ARNE_SALSV|7e-44|100.0|76/111| GO:SWS:NREP 8 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0009245|"GO:lipid A biosynthetic process"|Lipid A biosynthesis| GO:SWS GO:0008610|"GO:lipid biosynthetic process"|Lipid synthesis| GO:SWS GO:0009103|"GO:lipopolysaccharide biosynthetic process"|Lipopolysaccharide biosynthesis| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 4 TM:REGION 1->23| TM:REGION 36->58| TM:REGION 63->85| TM:REGION 90->111| SEG 2->18|igivlvlasllsvggql| SEG 95->110|lgvaliisgiiilgsa| HM:PFM:NREP 1 HM:PFM:REP 4->100|PF00893|1.8e-11|30.3|89/93|Multi_Drug_Res| HM:SCP:REP 4->107|1s7bA_|4.1e-12|34.4|96/106|f.39.1.1|1/1|Multidrug resistance efflux transporter EmrE| OP:NHOMO 56 OP:NHOMOORG 56 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------111-11111-11-1111111111111111111111--1111111111111111111--1--11-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 110-112| PSIPRED cHHHHHHHHHHHHHHHHHHHHHccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccc //