[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69521.1
DDBJ      :             curli production assembly/transport component CsgG
Swiss-Prot:CSGG_SALTY   RecName: Full=Curli production assembly/transport component csgG;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  86/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:277 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   47->243 PF03783 * CsgG 4e-32 48.1 %
:HMM:PFM   41->255 PF03783 * CsgG 4.1e-69 44.9 207/209  
:BLT:SWISS 1->277 CSGG_SALTY e-151 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69521.1 GT:GENE ACF69521.1 GT:PRODUCT curli production assembly/transport component CsgG GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1232374..1233207) GB:FROM 1232374 GB:TO 1233207 GB:DIRECTION - GB:PRODUCT curli production assembly/transport component CsgG GB:NOTE identified by match to protein family HMM PF03783 GB:PROTEIN_ID ACF69521.1 GB:DB_XREF GI:194409302 LENGTH 277 SQ:AASEQ MPRLLILVAVLLLSGCLTAPPKQAAKPTLMPRAQSYKDLTHLPAPTGKIFVSVYNIQDETGQFKPYPASNFSTAVPQSATAMLVTALKDSRWFIPLERQGLQNLLNERKIIRAAQENGTVAMNNRIPLQSLTAANIMVEGSIIGYESNVKSGGVGARYFGIGADTQYQLDQIAVNLRVVNVSTGEILSSVNTSKTILSYEVQAGVFRFIDYQRLLEGEIGYTSNEPVMLCLMSAIETGVIFLINDGIDRGLWDLQNKADRQNDILVKYRELSVPPES GT:EXON 1|1-277:0| SW:ID CSGG_SALTY SW:DE RecName: Full=Curli production assembly/transport component csgG;Flags: Precursor; SW:GN Name=csgG; OrderedLocusNames=STM1139; SW:KW Cell membrane; Complete proteome; Lipoprotein; Membrane; Palmitate;Signal. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->277|CSGG_SALTY|e-151|100.0|277/277| GO:SWS:NREP 2 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| TM:NTM 1 TM:REGION 1->23| SEG 4->13|llilvavlll| RP:PFM:NREP 1 RP:PFM:REP 47->243|PF03783|4e-32|48.1|181/193|CsgG| HM:PFM:NREP 1 HM:PFM:REP 41->255|PF03783|4.1e-69|44.9|207/209|CsgG| GO:PFM:NREP 1 GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF03783|IPR005534| OP:NHOMO 87 OP:NHOMOORG 86 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-1----------------1---1---------------------1---------------------------------------------------------------------------------------1--------------------1-------------------------------------------------------------------------------------1---1-1-1111111-1111111-1-1-------------1----1-1111111111-1111111111111111111--------1-11111111111111---1---1------------------------------1--------------------------------1-1--11111--------------11------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,22-34,111-124,270-270,272-278| PSIPRED ccHHHHHHHHHHHHHcccccccccccccccccccccccHHHccccccccEEEEccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEEEEcccccccccccHHHcccccccEEEEEEEEEEEEEEEcccEEEEEEEEEEEEEEEEEcccEEEEEccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHccccccc //