[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69525.1
DDBJ      :             phage-holin analog protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:100 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->72 PF00664 * ABC_membrane 0.00037 15.5 71/275  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69525.1 GT:GENE ACF69525.1 GT:PRODUCT phage-holin analog protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1119456..1119758 GB:FROM 1119456 GB:TO 1119758 GB:DIRECTION + GB:PRODUCT phage-holin analog protein GB:PROTEIN_ID ACF69525.1 GB:DB_XREF GI:194409306 LENGTH 100 SQ:AASEQ MDKHTTWLAYIWALISGICAQWTLNDYGALIGIVLGIGTFLVNKHYKKKSEQAQARQAAAMEERNRLIARILEKNDHDSTLKMLAVSEMPEGSNGGQDKS GT:EXON 1|1-100:0| TM:NTM 1 TM:REGION 14->36| SEG 51->66|eqaqarqaaameernr| HM:PFM:NREP 1 HM:PFM:REP 2->72|PF00664|0.00037|15.5|71/275|ABC_membrane| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,52-62,88-101| PSIPRED cccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //