[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69538.1
DDBJ      :             inner membrane protein YddG
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  138/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:307 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  55->159 1s7bA_ f.39.1.1 * 6.6e-06 22.9 %
:HMM:SCOP  202->309 1s7bA_ f.39.1.1 * 2.8e-07 24.8 %
:HMM:PFM   29->151 PF00892 * EamA 1.1e-09 24.4 123/126  
:HMM:PFM   181->299 PF00892 * EamA 2.2e-10 19.3 119/126  
:BLT:SWISS 15->306 YDDG_ECOLI e-135 84.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69538.1 GT:GENE ACF69538.1 GT:PRODUCT inner membrane protein YddG GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1702575..1703498 GB:FROM 1702575 GB:TO 1703498 GB:DIRECTION + GB:PRODUCT inner membrane protein YddG GB:NOTE identified by match to protein family HMM PF00892 GB:PROTEIN_ID ACF69538.1 GB:DB_XREF GI:194409319 LENGTH 307 SQ:AASEQ MAVYFARYSGQSQSMTSQKATLIGLVAIVLWSTMVGLIRGVSEGLGPVGGAAIIYSLSGLLLIFTVGLPDIRRFPGRYLIAGSVLFVSYEICLALSLGYAATRHQAIEVGMVNYLWPSLTILFAILFNGQKTNWLIVPGLLIALTGVCWVLGGENGLNPGEIISNVATSPLSYLLAFLGAFIWATYCTVTNKYARGFNGITVFVLLTAVALWFHYFLTPQPAMIFSLPVIAKLFTAALTLGFAYAAWNVGILHGNVTIMAVGSYFTPVMSSALAALLLSSPLSFSFWQGAVMVCVGSLLCWLATRRR GT:EXON 1|1-307:0| BL:SWS:NREP 1 BL:SWS:REP 15->306|YDDG_ECOLI|e-135|84.9|292/293| TM:NTM 10 TM:REGION 19->41| TM:REGION 48->70| TM:REGION 79->101| TM:REGION 106->128| TM:REGION 136->158| TM:REGION 169->191| TM:REGION 196->218| TM:REGION 227->249| TM:REGION 259->281| TM:REGION 283->304| SEG 270->283|ssalaalllsspls| HM:PFM:NREP 2 HM:PFM:REP 29->151|PF00892|1.1e-09|24.4|123/126|EamA| HM:PFM:REP 181->299|PF00892|2.2e-10|19.3|119/126|EamA| HM:SCP:REP 55->159|1s7bA_|6.6e-06|22.9|105/106|f.39.1.1|1/2|Multidrug resistance efflux transporter EmrE| HM:SCP:REP 202->309|1s7bA_|2.8e-07|24.8|105/106|f.39.1.1|2/2|Multidrug resistance efflux transporter EmrE| OP:NHOMO 144 OP:NHOMOORG 139 OP:PATTERN -------------------------------------------------------1------------ --------------------------------------11-------------------------------1---111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1-------------------1---------1--111111111-1----------------------------1-----------------------------------------1111----------------1--1111--111--1--1---------1-------------------------------------------------------------------------------------11------1--------------1----------1111-111111111111-1111111111111111111111121-111111111111-1-1111111111--111111111111-----------------1---------------21213----------------------------------11111111111111--1---------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEHHHHHHHHHHEEEccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccHHHccHHHHHHHHHHHHHHHHccc //