[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69560.1
DDBJ      :             ferritin, Dps family protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  210/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.1
:167 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->158 1eumA PDBj 2e-26 36.6 %
:RPS:PDB   6->159 3e6sA PDBj 6e-18 22.7 %
:RPS:SCOP  6->158 1eumA  a.25.1.1 * 2e-35 36.6 %
:HMM:SCOP  1->158 1s3qA1 a.25.1.1 * 1.9e-33 29.1 %
:RPS:PFM   7->141 PF00210 * Ferritin 3e-05 27.4 %
:HMM:PFM   8->142 PF00210 * Ferritin 1.7e-23 23.9 134/142  
:BLT:SWISS 1->167 FTNB_SHIFL 6e-71 76.6 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69560.1 GT:GENE ACF69560.1 GT:PRODUCT ferritin, Dps family protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2075587..2076090 GB:FROM 2075587 GB:TO 2076090 GB:DIRECTION + GB:PRODUCT ferritin, Dps family protein GB:NOTE identified by match to protein family HMM PF00210 GB:PROTEIN_ID ACF69560.1 GB:DB_XREF GI:194409341 LENGTH 167 SQ:AASEQ MAAVGMVQKLNTPMNLEFYASNLYLHLSEWCSEHSLTGTATFLRTQAQGNVTQMMRMFNFMKNAGATPIVKAIDVPGEELCSLEELFQKTLEDYQQRASTLSRLADEAKALNDASTLDFLHTLEKEQQQDGVLLQTILEEVRSAKRAGLCLAQTDQHLLNVVTYQHH GT:EXON 1|1-167:0| BL:SWS:NREP 1 BL:SWS:REP 1->167|FTNB_SHIFL|6e-71|76.6|167/167| COIL:NAA 28 COIL:NSEG 1 COIL:REGION 88->115| BL:PDB:NREP 1 BL:PDB:REP 6->158|1eumA|2e-26|36.6|153/161| RP:PDB:NREP 1 RP:PDB:REP 6->159|3e6sA|6e-18|22.7|154/159| RP:PFM:NREP 1 RP:PFM:REP 7->141|PF00210|3e-05|27.4|135/141|Ferritin| HM:PFM:NREP 1 HM:PFM:REP 8->142|PF00210|1.7e-23|23.9|134/142|Ferritin| GO:PFM:NREP 2 GO:PFM GO:0006879|"GO:cellular iron ion homeostasis"|PF00210|IPR008331| GO:PFM GO:0008199|"GO:ferric iron binding"|PF00210|IPR008331| RP:SCP:NREP 1 RP:SCP:REP 6->158|1eumA|2e-35|36.6|153/161|a.25.1.1| HM:SCP:REP 1->158|1s3qA1|1.9e-33|29.1|158/0|a.25.1.1|1/1|Ferritin-like| OP:NHOMO 290 OP:NHOMOORG 218 OP:PATTERN ---------------------------------------1--1------1-----1---11-----11 ------------------------------------------------------------------------------------------------1--1-1------------------------1----1--11-------------1---------------1--------------------------1-11111111-11111111----111--------------1-------------------------------------------------------------------------------------------11-11111111-1-1-11-1111----------------11-111----------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--1--1----------111111211111111-------11----1----11111--1111111111111------------2211-212222222222-22222222222222222222221111122222222222222221212222211111111111111--1---------------22222222222-222--------------------------------------111111111111111-----------------1-------------------------------------------11-1-------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 166 STR:RPRED 99.4 SQ:SECSTR cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccccccccccGGTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcTTHHHHHHHcccHHHHHHH# DISOP:02AL 1-1,160-160,162-168| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEcccccccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHc //