[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69586.1
DDBJ      :             protein YcgL
Swiss-Prot:YCGL_SALTY   RecName: Full=UPF0745 protein ycgL;

Homologs  Archaea  0/68 : Bacteria  174/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   42->144 2h7aA PDBj 3e-49 84.5 %
:RPS:PFM   50->123 PF05166 * YcgL 4e-26 71.6 %
:HMM:PFM   50->123 PF05166 * YcgL 1.3e-35 60.8 74/74  
:BLT:SWISS 35->144 YCGL_SALTY 7e-60 99.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69586.1 GT:GENE ACF69586.1 GT:PRODUCT protein YcgL GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1959473..1959907) GB:FROM 1959473 GB:TO 1959907 GB:DIRECTION - GB:PRODUCT protein YcgL GB:NOTE identified by match to protein family HMM PF05166 GB:PROTEIN_ID ACF69586.1 GB:DB_XREF GI:194409367 LENGTH 144 SQ:AASEQ MACLTSWPYSICYLSSPIRSDIPKSRRHVIVSIILRQVTIPLIQSKSMFCVIYRSSKRDQTYLYVEKKDDFSRVPEALMKGFGQPQLAMMLPLDGRKKLVNAELEKVKQALSEQGYYLQLPPPPEDLLKQHLSSVGQNTSPADR GT:EXON 1|1-144:0| SW:ID YCGL_SALTY SW:DE RecName: Full=UPF0745 protein ycgL; SW:GN Name=ycgL; OrderedLocusNames=STM1813; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 35->144|YCGL_SALTY|7e-60|99.1|110/110| BL:PDB:NREP 1 BL:PDB:REP 42->144|2h7aA|3e-49|84.5|103/110| RP:PFM:NREP 1 RP:PFM:REP 50->123|PF05166|4e-26|71.6|74/74|YcgL| HM:PFM:NREP 1 HM:PFM:REP 50->123|PF05166|1.3e-35|60.8|74/74|YcgL| OP:NHOMO 174 OP:NHOMOORG 174 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-1111111111111111111111111---1--1------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1----------11111111111111111111-11111---1111111111111111111---------11111111111111111----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 103 STR:RPRED 71.5 SQ:SECSTR #########################################ccccccccEEEEEETTccccEEEEccccccccccHHHHHHHccEEEEEEEccccccccccccHHHHHHHHHHTcEEEEccccccccccccccccccccccccc DISOP:02AL 1-1,131-145| PSIPRED cccccccccEEEEEcccHHHcccccHHHHHHHHHHHHHHHHHHHHccEEEEEEEcccccccEEEEcccccHHHccHHHHHHccccEEEEEEEccccHHHHHccHHHHHHHHHHcccEEEccccHHHHHHHHHHHHHHHcccccc //