[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69591.1
DDBJ      :             tRNA-specific adenosine deaminase
Swiss-Prot:TADA_SALTY   RecName: Full=tRNA-specific adenosine deaminase;         EC=3.5.4.-;

Homologs  Archaea  19/68 : Bacteria  826/915 : Eukaryota  154/199 : Viruses  0/175   --->[See Alignment]
c.97.1
:172 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->157 1z3aA PDBj 2e-85 91.7 %
:RPS:PDB   7->154 2b3jD PDBj 5e-49 45.9 %
:RPS:SCOP  6->156 1wwrA1  c.97.1.2 * 6e-49 42.7 %
:HMM:SCOP  6->157 1wwrA1 c.97.1.2 * 1.8e-57 52.3 %
:RPS:PFM   9->105 PF00383 * dCMP_cyt_deam_1 7e-22 57.6 %
:HMM:PFM   7->105 PF00383 * dCMP_cyt_deam_1 7.3e-30 39.8 98/102  
:BLT:SWISS 1->172 TADA_SALTY e-100 100.0 %
:PROS 57->94|PS00903|CYT_DCMP_DEAMINASES

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69591.1 GT:GENE ACF69591.1 GT:PRODUCT tRNA-specific adenosine deaminase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2770680..2771198) GB:FROM 2770680 GB:TO 2771198 GB:DIRECTION - GB:PRODUCT tRNA-specific adenosine deaminase GB:NOTE identified by match to protein family HMM PF00383 GB:PROTEIN_ID ACF69591.1 GB:DB_XREF GI:194409372 LENGTH 172 SQ:AASEQ MSDVELDHEYWMRHALTLAKRAWDEREVPVGAVLVHNHRVIGEGWNRPIGRHDPTAHAEIMALRQGGLVLQNYRLLDTTLYVTLEPCVMCAGAMVHSRIGRVVFGARDAKTGAAGSLIDVLHHPGMNHRVEIIEGVLRDECATLLSDFFRMRRQEIKALKKADRAEGAGPAV GT:EXON 1|1-172:0| SW:ID TADA_SALTY SW:DE RecName: Full=tRNA-specific adenosine deaminase; EC=3.5.4.-; SW:GN Name=tadA; OrderedLocusNames=STM2568; SW:KW Complete proteome; Hydrolase; Metal-binding; tRNA processing; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->172|TADA_SALTY|e-100|100.0|172/172| GO:SWS:NREP 3 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0008033|"GO:tRNA processing"|tRNA processing| PROS 57->94|PS00903|CYT_DCMP_DEAMINASES|PDOC00702| BL:PDB:NREP 1 BL:PDB:REP 2->157|1z3aA|2e-85|91.7|156/156| RP:PDB:NREP 1 RP:PDB:REP 7->154|2b3jD|5e-49|45.9|148/150| RP:PFM:NREP 1 RP:PFM:REP 9->105|PF00383|7e-22|57.6|92/100|dCMP_cyt_deam_1| HM:PFM:NREP 1 HM:PFM:REP 7->105|PF00383|7.3e-30|39.8|98/102|dCMP_cyt_deam_1| GO:PFM:NREP 2 GO:PFM GO:0008270|"GO:zinc ion binding"|PF00383|IPR002125| GO:PFM GO:0016787|"GO:hydrolase activity"|PF00383|IPR002125| RP:SCP:NREP 1 RP:SCP:REP 6->156|1wwrA1|6e-49|42.7|150/151|c.97.1.2| HM:SCP:REP 6->157|1wwrA1|1.8e-57|52.3|151/0|c.97.1.2|1/1|Cytidine deaminase-like| OP:NHOMO 1562 OP:NHOMOORG 999 OP:PATTERN ------------------------1----11-1-----111111-111-2212-----11-------- 21212-1211111122211-12112111111111111322112121311111333111111112212221111112111112122221333312331--22222232223111111111111111332222122231---------233422222231122132222333211121111122111111111122111113141111211212223111111231111111123111111--11111111221111112211111111122111112111222111111122222222222-111111111111111111111121122333333323222112221112111221211211121122212111123111-11111123221121111111111111111-121212231111111212222211111111111111211111111111111112111112111111111111111111111112-111111111122232222222222322222232221121122211211311121311111211221211122211322234111312221222112122311111122--------------------21--1111111211221212222221344213112111-2311221111111212122222221222-2222222222222222222212111122222222222222222122222122111111111111111222222211113212211112121111222133333332221322224212122223333111111111211121111122111332323322222222211----1-----------11111-------------------------------532 ---122----112212221---1112-221111111-111-1111---11---------1-1212211-22212111111111121-1-13221211-111-11-1-1621222342-11112-21221362-213111-21112-2---11-2111122-113-111-153212311222223244461312232222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 167 STR:RPRED 97.1 SQ:SECSTR cccccHcHHHHHHHHHHHHHHHHTTTccccEEEEEETTEEEEEEEccHHHHTcTTccHHHHHHHHHHHHHTccccTTcEEEEEEcccHHHHHHHHHHTccEEEEEEccTTTcTcTTcccGGGcTTcccccEEEccTTHHHHHHHHHHHHHHHHHcccccTTHHHHTc##### DISOP:02AL 1-3,168-173| PSIPRED cccccccHHHHHHHHHHHHHHHHHccccEEEEEEEEccEEEEEEccccccccccccHHHHHHHHHHHHHcccccccccEEEEEccccHHHHHHHHHccccEEEEEEEccccccccHHHHHHHccccccccEEEcccHHHHHHHHHHHHHHHHccccHHHHHHcccccccccc //