[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF69610.1
DDBJ      :             replication protein P
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  50/915 : Eukaryota  0/199 : Viruses  5/175   --->[See Alignment]
:233 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   35->201 PF06992 * Phage_lambda_P 2e-62 70.7 %
:HMM:PFM   1->231 PF06992 * Phage_lambda_P 1.1e-139 80.5 231/233  
:BLT:SWISS 1->230 VRPP_LAMBD e-111 81.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69610.1 GT:GENE ACF69610.1 GT:PRODUCT replication protein P GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1110884..1111585 GB:FROM 1110884 GB:TO 1111585 GB:DIRECTION + GB:PRODUCT replication protein P GB:NOTE identified by match to protein family HMM PF06992 GB:PROTEIN_ID ACF69610.1 GB:DB_XREF GI:194409391 LENGTH 233 SQ:AASEQ MKNIAAQMVNFDREQMRRIANNMPEQHDDKPQVEQVAKVINNVFSQLMAAFPATTANRSQAEMNEIRRQWVLAFRENDITTMEQVAAGMRVARRQERPFLPSPGQFVAWCKAELTTAAGLPDANELVDMVYQYCRTRGLYPDAESYPWESKAHYWLVTTLYSNMRANALSDTELRRKAVEELNHMVTRINRGEVIPEPVKQLPVLGGRPLNRAQNLAKIAEIRAKFGLKGVRS GT:EXON 1|1-233:0| BL:SWS:NREP 1 BL:SWS:REP 1->230|VRPP_LAMBD|e-111|81.7|230/233| RP:PFM:NREP 1 RP:PFM:REP 35->201|PF06992|2e-62|70.7|167/196|Phage_lambda_P| HM:PFM:NREP 1 HM:PFM:REP 1->231|PF06992|1.1e-139|80.5|231/233|Phage_lambda_P| GO:PFM:NREP 1 GO:PFM GO:0006270|"GO:DNA-dependent DNA replication initiation"|PF06992|IPR009731| OP:NHOMO 78 OP:NHOMOORG 55 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------16511----1---------------------11--11--231-1121--3-11-21111412111-11-----2--1------11-1----1--------1-1--------------------------1--1--11--2--1211------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------1--------------------------------------------------------------------------------------------11----1--------1-------------------- DISOP:02AL 1-2,4-6,20-30,232-234| PSIPRED cHHHHHHHHHccHHHHHHHHHHccHHHHcccHHHHHHHHHHHHHHHHHHHcHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccc //